KEGG   Homo sapiens (human): 6543Help
Entry
6543              CDS       T01001                                 

Gene name
SLC8A2, NCX2
Definition
solute carrier family 8 (sodium/calcium exchanger), member 2
Orthology
K05849  
solute carrier family 8 (sodium/calcium exchanger)
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Protein digestion and absorption
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.3
AA seq 921 aa AA seqDB search
MAPLALVGVTLLLAAPPCSGAATPTPSLPPPPANDSDTSTGGCQGSYRCQPGVLLPVWEP
DDPSLGDKAARAVVYFVAMVYMFLGVSIIADRFMAAIEVITSKEKEITITKANGETSVGT
VRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVC
IYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVWEALLTLVFFPVCV
VFAWMADKRLLFYKYVYKRYRTDPRSGIIIGAEGDPPKSIELDGTFVGAEAPGELGGLGP
GPAEARELDASRREVIQILKDLKQKHPDKDLEQLVGIANYYALLHQQKSRAFYRIQATRL
MTGAGNVLRRHAADASRRAAPAEGAGEDEDDGASRIFFEPSLYHCLENCGSVLLSVTCQG
GEGNSTFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGETQKELRIGIIDDDIFEEDEHFFV
RLLNLRVGDAQGMFEPDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGT
VDVRVVRSSGARGTVRLPYRTVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEE
YEKKDNFFIELGQPQWLKRGISALLLNQGDGDRKLTAEEEEARRIAEMGKPVLGENCRLE
VIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFLEAITVSAGDEEEEEDGSREERLPS
CFDYVMHFLTVFWKVLFACVPPTEYCHGWACFGVSILVIGLLTALIGDLASHFGCTVGLK
DSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVY
WAVQGRPFEVRTGTLAFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPRGPKLATTALFL
GLWLLYILFASLEAYCHIRGF
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggctcccctggccttggtgggggtcacactcctcctggcggctcccccatgctccggg
gcagccaccccaaccccctccctgccgcctcccccggccaatgacagcgacaccagcaca
gggggctgccaggggtcctaccgctgccagccgggggtgctgctgcccgtgtgggagccc
gacgacccgtcgctgggtgacaaggcggcacgggcagtggtgtactttgtggccatggtc
tacatgtttctgggagtgtccatcatcgccgaccgtttcatggcggccatcgaggtcatc
acgtcaaaagagaaggagatcaccatcaccaaggccaacggtgagaccagcgtgggcacc
gttcgcatctggaatgagacggtgtccaacctcacgctcatggccctgggctcctccgca
cctgagatcctgctgtcagtcatcgaagtctgcggccacaacttccaggcgggtgagctg
ggcccaggcaccatcgtgggcagcgctgccttcaacatgtttgtggtcatcgccgtgtgc
atctacgtcatcccagccggcgagagccgcaagatcaagcacctgagagtcttctttgtc
actgcctcttggagcatcttcgcctatgtctggctttatctcatccttgctgttttttcc
cccggtgtggtccaggtgtgggaggcgctgctgaccctggtcttcttcccggtgtgcgtg
gtattcgcctggatggccgacaagcggctgctcttctacaagtacgtgtacaagcgctac
cgcaccgacccacgcagcggcatcatcataggcgccgagggcgaccccccgaagagcatc
gagctggacggcacgttcgtgggcgccgaggccccaggtgagctgggcggcctgggcccg
ggccccgccgaggcgcgcgagctggacgccagccgccgcgaggtcatccagatcctcaag
gacctcaagcagaagcacccggacaaggatctggagcagctggtgggcatcgccaactac
tacgcgctgctgcaccagcagaagagccgcgccttctaccgcatccaggccacgcggctg
atgaccggcgccgggaacgtgctgcgcagacacgcggcggacgcctcgcgcagggcggcg
ccggccgagggcgcgggcgaggacgaagacgacggcgccagccgcatcttcttcgagcct
agcctctaccactgcctggagaactgcggctccgtgctgctgtccgtcacgtgccagggc
ggcgagggcaacagcaccttctacgtggactaccgcactgaggacggctctgccaaggcg
ggctccgactacgagtacagcgagggcacgctggtgttcaaaccaggcgagacgcagaag
gagctgcgcatcggcatcatcgacgacgacatcttcgaggaggacgagcatttcttcgtg
cggctgctgaacctgcgcgtgggcgacgcgcagggcatgttcgagccggacggcggcggg
cggcccaaggggcggctggtggcgccgctgctggccaccgtcaccatcctggacgacgac
cacgcaggcatcttctccttccaggaccgcctgctgcacgtgagcgagtgcatgggcacc
gtggacgtgcgcgtcgtgcgcagctcgggcgcgcgcggcaccgtgcgccttccctaccgc
acggtggacggcacggcgcgcggcggcggcgtgcactacgaggacgcgtgcggagagctg
gagtttggcgacgacgagaccatgaaaactcttcaggtgaagatagttgatgacgaggaa
tatgagaaaaaggataatttcttcattgagctgggccagccccagtggcttaagcgaggg
atttcagctctgctactcaatcaaggggatggggacaggaagctaacagccgaggaggag
gaggctcggaggatagcagagatgggcaagccagttcttggggagaactgccggctggag
gtcatcatcgaggagtcatatgattttaagaacacggtggataaactcatcaagaaaacg
aacttggccttggtaattgggacccattcatggagggagcagtttttagaggcaattacg
gtgagcgcaggggacgaggaggaggaggaggacgggtcccgggaggagcggctgccgtcg
tgctttgactacgtgatgcacttcctgacggtgttctggaaggtgctcttcgcctgtgtg
ccccccaccgagtactgccacggctgggcctgctttggtgtctccatcctggtcatcggc
ctgctcaccgccctcattggggacctcgcctcccacttcggctgcaccgttggcctcaag
gactctgtcaatgctgttgtcttcgttgccctgggcacctccatccctgacacgttcgcc
agcaaggtggcggcgctgcaggaccagtgcgccgacgcgtccatcggcaacgtgaccggc
tccaacgcggtgaacgtgttccttggcctgggcgtcgcctggtctgtggccgccgtgtac
tgggcggtgcagggccgccccttcgaggtgcgcactggcacgctggccttctccgtcacg
ctcttcaccgtcttcgccttcgtgggcattgccgtgctgctgtaccggcgccggccgcac
atcggcggcgagctgggcggcccgcgcggacccaagctcgccaccaccgcgctcttcctg
ggcctctggctcctgtacatcctcttcgccagcctggaggcgtactgccacatccggggc
ttctag

DBGET integrated database retrieval system