KEGG   Homo sapiens (human): 6546Help
Entry
6546              CDS       T01001                                 

Gene name
SLC8A1, NCX1
Definition
(RefSeq) solute carrier family 8 member A1
  KO
K05849  
solute carrier family 8 (sodium/calcium exchanger)
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Olfactory transduction
Endocrine and other factor-regulated calcium reabsorption
Protein digestion and absorption
Mineral absorption
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    6546 (SLC8A1)
   04022 cGMP - PKG signaling pathway
    6546 (SLC8A1)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    6546 (SLC8A1)
   04261 Adrenergic signaling in cardiomyocytes
    6546 (SLC8A1)
  Digestive system
   04974 Protein digestion and absorption
    6546 (SLC8A1)
   04978 Mineral absorption
    6546 (SLC8A1)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    6546 (SLC8A1)
  Sensory system
   04740 Olfactory transduction
    6546 (SLC8A1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    6546 (SLC8A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    6546 (SLC8A1)
   05414 Dilated cardiomyopathy (DCM)
    6546 (SLC8A1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC8: Na+/Ca2+ exchanger
   6546 (SLC8A1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Others
   6546 (SLC8A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
2p22.1
AA seq 973 aa AA seqDB search
MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGVI
LPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNG
ETTKTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMF
IIIALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVISPGVVEVWEGLLTFF
FFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPSSKTEIEMDGKVVNSHV
ENFLDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELANYQVLSQQQKS
RAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE
NCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGII
DDDIFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIF
TFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQND
EIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKALLLNELGGFTITGKYLFGQPV
FRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESY
EFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKLPSCFDYVMHF
LTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVF
VALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQF
KVSPGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSCLFVLLWLLYIF
FSSLEAYCHIKGF
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacatgcggcgattaagtctttcacccaccttttcaatgggatttcatctgtta
gttactgtgagtctcttattttcccatgtggaccatgtaattgctgagacagaaatggaa
ggagaaggaaatgaaactggtgaatgtactggatcatattactgtaagaaaggggtgatt
ttgcccatttgggaaccccaagacccttcttttggggacaaaattgctagagctactgtg
tattttgtggccatggtctacatgtttcttggagtctctatcatagctgatcggttcatg
tcctctatagaagtcatcacatctcaagaaaaagaaataaccataaagaaacccaatgga
gagaccaccaagacaactgtgaggatctggaatgaaacagtttctaacctgaccttgatg
gccctgggatcttctgctcctgagattctcctttcagtaattgaagtgtgtggccataac
ttcactgcaggagacctcggtcctagcaccatcgtgggaagtgctgcattcaatatgttc
atcattattgcactctgtgtttatgtggtgcctgacggagagacaaggaagattaagcat
ttgcgtgtcttctttgtgacagcagcctggagcatctttgcctacacctggctttacatt
attttgtctgtcatatctcctggtgttgtggaggtctgggaaggtttgcttactttcttc
ttctttcccatctgtgttgtgttcgcttgggtagcggataggagacttctgttttacaag
tatgtctacaagaggtatcgagctggcaagcagagggggatgattattgaacatgaagga
gacaggccatcttctaagactgaaattgaaatggacgggaaagtggtcaattctcatgtt
gaaaatttcttagatggtgctctggttctggaggtggatgagagggaccaagatgatgaa
gaagctaggcgagaaatggctaggattctgaaggaacttaagcagaagcatccagataaa
gaaatagagcaattaatagaattagctaactaccaagtcctaagtcagcagcaaaaaagt
agagcattttatcgcattcaagctactcgcctcatgactggagctggcaacattttaaag
aggcatgcagctgaccaagcaaggaaggctgtcagcatgcacgaggtcaacactgaagtg
actgaaaatgaccctgttagtaagatcttctttgaacaagggacatatcagtgtctggag
aactgtggtactgtggcccttaccattatccgcagaggtggtgatttgactaacactgtg
tttgttgacttcagaacagaggatggcacagcaaatgctgggtctgattatgaatttact
gaaggaactgtggtgtttaagcctggtgatacccagaaggaaatcagagtgggtatcata
gatgatgatatctttgaggaggatgaaaatttccttgtgcatctcagcaatgtcaaagta
tcttctgaagcttcagaagatggcatactggaagccaatcatgtttctacacttgcttgc
ctcggatctccctccactgccactgtaactatttttgatgatgaccacgcaggcattttt
acttttgaggaacctgtgactcatgtgagtgagagcattggcatcatggaggtgaaagta
ttgagaacatctggagctcgaggaaatgttatcgttccatataaaaccatcgaagggact
gccagaggtggaggggaggattttgaggacacttgtggagagctcgaattccagaatgat
gaaattgtcaaaacaatatcagtcaaggtaattgatgatgaggagtatgagaaaaacaag
accttcttccttgagattggagagccccgcctggtggagatgagtgagaagaaagccctg
ttattgaatgagcttggtggcttcacaataacaggaaaatacctgtttggccaacctgtc
ttcaggaaggttcatgctagagaacatccgattctctctactgtaatcaccattgcagac
gaatatgatgacaagcagccactgaccagcaaagaggaagaggagaggcgcattgcagaa
atggggcgccccatcctgggagagcacaccaagttggaagtgatcattgaagaatcctat
gaattcaagagtactgtggacaaactcattaagaagacaaacctggcccttgtggttggg
actaacagctggagagaacagttcattgaagctatcactgtcagtgctggggaagatgat
gacgacgatgaatgtggggaagagaagctgccctcctgtttcgattacgtgatgcacttt
ctgactgtgttctggaaggtcctgtttgccttcgtcccccctactgaatactggaatggc
tgggcgtgtttcattgtctccatcctcatgattggcctactgacagctttcattggagac
ctggcttcccactttggctgcaccattggcctgaaagattctgtgactgcagtcgtgttc
gtcgcacttggaacatcagtgccagacacatttgccagcaaagtggcagccacccaggac
cagtatgcagacgcctccataggtaacgtcacgggcagcaacgcggtgaatgtcttcctg
ggaatcggtgtggcctggtccatcgctgccatctaccacgcagccaatggggaacagttc
aaagtgtcccctggcacactagctttctctgtcactctcttcaccatttttgctttcatc
aatgtgggggtgctgctgtatcggcggaggccagaaatcggaggtgagctgggtgggccc
cggactgccaagctcctcacatcctgcctctttgtgctcctatggctcttgtacattttc
ttctcctccctggaggcctactgccacataaaaggcttctaa

DBGET integrated database retrieval system