KEGG   Homo sapiens (human): 6547Help
Entry
6547              CDS       T01001                                 

Gene name
SLC8A3, NCX3
Definition
solute carrier family 8 (sodium/calcium exchanger), member 3
Orthology
K05849  
solute carrier family 8 (sodium/calcium exchanger)
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    6547 (SLC8A3)
   04022 cGMP - PKG signaling pathway
    6547 (SLC8A3)
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    6547 (SLC8A3)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Others
  6547 (SLC8A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q24.1
AA seq 298 aa AA seqDB search
MERGISDVTDRKLTMEEEEAKRIAEMGKPVLGEHPKLEVIIEESYEFKTTVDKLIKKTNL
ALVVGTHSWRDQFMEAITVSAAGDEDEDESGEERLPSCFDYVMHFLTVFWKVLFACVPPT
EYCHGWACFAVSILIIGMLTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKA
AALQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWALQGQEFHVSAGTLAFSVTLFT
IFAFVCISVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWLLYILFATLEAYCYIKGF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtggaatatcagatgtgacagacaggaagctgactatggaagaagaggaggcc
aagaggatagcagagatgggaaagccagtattgggtgaacaccccaaactagaagtcatc
attgaagagtcctatgagttcaagactacggtggacaaactgatcaagaagacaaacctg
gccttggttgtggggacccattcctggagggaccagttcatggaggccatcaccgtcagt
gcagcaggggatgaggatgaggatgaatccggggaggagaggctgccctcctgctttgac
tacgtcatgcacttcctgactgtcttctggaaggtgctgtttgcctgtgtgccccccaca
gagtactgccacggctgggcctgcttcgccgtctccatcctcatcattggcatgctcacc
gccatcattggggacctggcctcgcacttcggctgcaccattggtctcaaagattcagtc
acagctgttgttttcgtggcatttggcacctctgtcccagatacgtttgccagcaaagct
gctgccctccaggatgtatatgcagacgcctccattggcaacgtgacgggcagcaacgcc
gtcaatgtcttcctgggcatcggcctggcctggtccgtggccgccatctactgggctctg
cagggacaggagttccacgtgtcggccggcacactggccttctccgtcaccctcttcacc
atctttgcatttgtctgcatcagcgtgctcttgtaccgaaggcggccgcacctgggaggg
gagcttggtggcccccgtggctgcaagctcgccacaacatggctctttgtgagcctgtgg
ctcctctacatactctttgccacactagaggcctattgctacatcaaggggttctaa

DBGET integrated database retrieval system