KEGG   Homo sapiens (human): 655Help
Entry
655               CDS       T01001                                 

Gene name
BMP7, OP-1
Definition
bone morphogenetic protein 7
Orthology
K16621  
bone morphogenetic protein 7
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Hippo signaling pathway
Module
BMP signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    655 (BMP7)
   04390 Hippo signaling pathway
    655 (BMP7)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    655 (BMP7)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Morphogens (General comment) Effective diffusion, tissue differentiation, development
  655 (BMP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13
AA seq 431 aa AA seqDB search
MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILS
ILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLAS
LQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDY
IRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPR
HNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRS
QNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCE
GECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKY
RNMVVRACGCH
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgcgctcactgcgagctgcggcgccgcacagcttcgtggcgctctgggcaccc
ctgttcctgctgcgctccgccctggccgacttcagcctggacaacgaggtgcactcgagc
ttcatccaccggcgcctccgcagccaggagcggcgggagatgcagcgcgagatcctctcc
attttgggcttgccccaccgcccgcgcccgcacctccagggcaagcacaactcggcaccc
atgttcatgctggacctgtacaacgccatggcggtggaggagggcggcgggcccggcggc
cagggcttctcctacccctacaaggccgtcttcagtacccagggcccccctctggccagc
ctgcaagatagccatttcctcaccgacgccgacatggtcatgagcttcgtcaacctcgtg
gaacatgacaaggaattcttccacccacgctaccaccatcgagagttccggtttgatctt
tccaagatcccagaaggggaagctgtcacggcagccgaattccggatctacaaggactac
atccgggaacgcttcgacaatgagacgttccggatcagcgtttatcaggtgctccaggag
cacttgggcagggaatcggatctcttcctgctcgacagccgtaccctctgggcctcggag
gagggctggctggtgtttgacatcacagccaccagcaaccactgggtggtcaatccgcgg
cacaacctgggcctgcagctctcggtggagacgctggatgggcagagcatcaaccccaag
ttggcgggcctgattgggcggcacgggccccagaacaagcagcccttcatggtggctttc
ttcaaggccacggaggtccacttccgcagcatccggtccacggggagcaaacagcgcagc
cagaaccgctccaagacgcccaagaaccaggaagccctgcggatggccaacgtggcagag
aacagcagcagcgaccagaggcaggcctgtaagaagcacgagctgtatgtcagcttccga
gacctgggctggcaggactggatcatcgcgcctgaaggctacgccgcctactactgtgag
ggggagtgtgccttccctctgaactcctacatgaacgccaccaaccacgccatcgtgcag
acgctggtccacttcatcaacccggaaacggtgcccaagccctgctgtgcgcccacgcag
ctcaatgccatctccgtcctctacttcgatgacagctccaacgtcatcctgaagaaatac
agaaacatggtggtccgggcctgtggctgccactag

DBGET integrated database retrieval system