KEGG   Homo sapiens (human): 6550Help
Entry
6550              CDS       T01001                                 

Gene name
SLC9A3, NHE3
Definition
solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3
Orthology
K12040  
solute carrier family 9 (sodium/hydrogen exchanger), member 3
Organism
hsa  Homo sapiens (human)
Pathway
Proximal tubule bicarbonate reclamation
Protein digestion and absorption
Bile secretion
Mineral absorption
Class
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
Organismal Systems; Digestive system; Mineral absorption [PATH:hsa04978]
Organismal Systems; Excretory system; Proximal tubule bicarbonate reclamation [PATH:hsa04964]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p15.3
AA seq 825 aa AA seqDB search
MWGLGARGPDRGLLLALALGGLARAGGVEVEPGGAHGESGGFQVVTFEWAHVQDPYVIAL
WILVASLAKIGFHLSHKVTSVVPESALLIVLGLVLGGIVWAADHIASFTLTPTVFFFYLL
PPIVLDAGYFMPNRLFFGNLGTILLYAVVGTVWNAATTGLSLYGVFLSGLMGDLQIGLLD
FLLFGSLMAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVALGGD
NVTGVDCVKGIVSFFVVSLGGTLVGVVFAFLLSLVTRFTKHVRIIEPGFVFIISYLSYLT
SEMLSLSAILAITFCGICCQKYVKANISEQSATTVRYTMKMLASSAETIIFMFLGISAVN
PFIWTWNTAFVLLTLVFISVYRAIGVVLQTWLLNRYRMVQLEPIDQVVLSYGGLRGAVAF
ALVVLLDGDKVKEKNLFVSTTIIVVFFTVIFQWLKVKRSEHREPRLNEKLHGRAFDHILS
AIEDISGQIGHNYLRDKWSHFDRKFLSRVLMRRSAQKSRDRILNVFHELNLKDAISYVAE
GERRGSLAFIRSPSTDNVVNVDFTPRSSTVEASVSYLLRENVSAVCLDMQSLEQRRRSIR
DAEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKRLESFKSTKL
GLNQNKKAAKLYKRERAQKRRNSSIPNGKLPMESPAQNFTIKEKDLELSDTEEPPNYDEE
MSGGIEFLASVTKDTASDSPAGIDNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRART
QIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPESTHM
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtggggactcggggcccggggccccgaccgggggctgctgctggcgctggcgctgggc
gggctggcgcgggccgggggcgtcgaggtggagcccggcggcgcgcacggcgagagcggg
ggcttccaggtggtcaccttcgagtgggcccacgtgcaggatccctacgtcatcgcgctc
tggatcctcgtggccagcttggccaagatcgggttccacctgtcccacaaggtcaccagc
gtggttcccgagagcgccctgctcatcgtgctgggcctggtgctgggcggcatcgtctgg
gcggccgaccacatcgcgtccttcacactgacgcccaccgtcttcttcttctacctgctg
ccccccatcgtgctggacgccggctacttcatgcccaaccgcctcttcttcggcaacctg
gggaccatcctgttgtacgccgtcgtgggtaccgtgtggaacgcggccaccaccgggctg
tccctctacggcgtcttcctcagtgggctcatgggcgacctgcagattgggctgctggac
ttcctcctgtttggcagcctcatggcggctgtggacccggtggccgtcctggccgtgttt
gaggaggtccatgtcaacgaggtcctgttcatcatcgtcttcggggagtcgctgctgaac
gacgcagtcaccgtggttctgtacaatgtgtttgaatctttcgtggcgctgggaggtgac
aacgtgactggcgtggactgcgtgaagggcatagtgtccttcttcgtggtgagcctgggg
ggcacgctggtgggggtggtcttcgccttcctgctgtcgctggtgacgcgcttcaccaag
catgtgcgtatcatcgagcccggcttcgtgttcatcatctcctacctgtcctacctgacg
tccgagatgctgtcgctgtcggccatcctcgccatcaccttctgtggcatctgctgtcag
aagtatgtgaaggccaacatctcggagcagtcggccaccaccgtgcgctacaccatgaag
atgctggccagcagcgccgagaccatcatcttcatgttcctgggtatctcggccgtgaac
ccgttcatctggacctggaacacggccttcgtgctcctgacgctggtcttcatctccgtg
taccgggccatcggtgtggtcctgcagacctggcttctgaaccgctaccgcatggtgcag
ctggagcccattgaccaggtggtcctgtcctacgggggcctgcgcggggccgtggccttt
gccctggtggtgcttctggatggagacaaggtcaaggagaagaacctgttcgtcagcacc
accatcatcgtagtgttcttcaccgtcatcttccagtggctgaaggtgaagaggagcgag
caccgggaacctcggctcaacgagaagctgcacgggcgcgctttcgaccacatcctctcg
gccatcgaggacatatccggacagatcgggcacaattatctcagagacaagtggtcccac
ttcgacaggaagttcctcagcagggtcctcatgagacggtcggcccagaagtctcgagac
cggatcctgaatgtcttccacgagctgaacctgaaggatgccatcagctacgtggctgag
ggagagcgccgcgggtccctggccttcatccgctcccccagcaccgacaacgtggtcaac
gtggacttcacgccacgatcgtccaccgtggaggcctctgtctcctacctcctgagagaa
aatgtcagcgctgtctgcctggacatgcagtctctggagcagcgacggcggagcatccgg
gacgcggaggacatggtcacgcaccacacgctacagcagtacctgtacaagccgcggcag
gagtacaagcatctgtacagccgacacgagctcacgcccacggaggacgagaaacaggac
cgggaaatcttccacaggaccatgcggaagcgcctggagtccttcaagtcgaccaagctg
gggctcaaccagaacaagaaggcggccaagctgtacaagcgggagcgtgcccagaagcgg
agaaacagcagcatccccaatgggaagctgcccatggagagccctgcgcagaatttcacc
atcaaggagaaagacttggaactttcagacaccgaggagccccccaactatgatgaggag
atgagtggggggatcgagttcctggctagtgtcaccaaggacacagcgtccgactcccct
gcaggaattgacaaccctgtgttttctccggacgaggccctggaccgcagcctcctggcc
aggctgccgccctggctgtctcccggggagacggtggtcccctcgcagagggcccgcacg
cagattccctactctcccggcaccttctgccgcctgatgcccttccgcctcagcagcaag
tccgtggactccttcctgcaggcagacggccccgaggagcggccccccgccgccctcccc
gagtccacacacatgtga

DBGET integrated database retrieval system