KEGG   Homo sapiens (human): 6550Help
Entry
6550              CDS       T01001                                 

Gene name
SLC9A3, DIAR8, NHE-3, NHE3
Definition
(RefSeq) solute carrier family 9 member A3
  KO
K12040  
solute carrier family 9 (sodium/hydrogen exchanger), member 3
Organism
hsa  Homo sapiens (human)
Pathway
Proximal tubule bicarbonate reclamation
Protein digestion and absorption
Bile secretion
Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    6550 (SLC9A3)
   04974 Protein digestion and absorption
    6550 (SLC9A3)
   04978 Mineral absorption
    6550 (SLC9A3)
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    6550 (SLC9A3)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC9: Na+/H+ exchanger
   6550 (SLC9A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p15.3
AA seq 834 aa AA seqDB search
MWGLGARGPDRGLLLALALGGLARAGGVEVEPGGAHGESGGFQVVTFEWAHVQDPYVIAL
WILVASLAKIGFHLSHKVTSVVPESALLIVLGLVLGGIVWAADHIASFTLTPTVFFFYLL
PPIVLDAGYFMPNRLFFGNLGTILLYAVVGTVWNAATTGLSLYGVFLSGLMGDLQIGLLD
FLLFGSLMAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVALGGD
NVTGVDCVKGIVSFFVVSLGGTLVGVVFAFLLSLVTRFTKHVRIIEPGFVFIISYLSYLT
SEMLSLSAILAITFCGICCQKYVKANISEQSATTVRYTMKMLASSAETIIFMFLGISAVN
PFIWTWNTAFVLLTLVFISVYRAIGVVLQTWLLNRYRMVQLEPIDQVVLSYGGLRGAVAF
ALVVLLDGDKVKEKNLFVSTTIIVVFFTVIFQGLTIKPLVQWLKVKRSEHREPRLNEKLH
GRAFDHILSAIEDISGQIGHNYLRDKWSHFDRKFLSRVLMRRSAQKSRDRILNVFHELNL
KDAISYVAEGERRGSLAFIRSPSTDNVVNVDFTPRSSTVEASVSYLLRENVSAVCLDMQS
LEQRRRSIRDAEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR
LESFKSTKLGLNQNKKAAKLYKRERAQKRRNSSIPNGKLPMESPAQNFTIKEKDLELSDT
EEPPNYDEEMSGGIEFLASVTKDTASDSPAGIDNPVFSPDEALDRSLLARLPPWLSPGET
VVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPESTHM
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgtggggactcggggcccggggccccgaccgggggctgctgctggcgctggcgctgggc
gggctggcgcgggccgggggcgtcgaggtggagcccggcggcgcgcacggcgagagcggg
ggcttccaggtggtcaccttcgagtgggcccacgtgcaggatccctacgtcatcgcgctc
tggatcctcgtggccagcttggccaagatcgggttccacctgtcccacaaggtcaccagc
gtggttcccgagagcgccctgctcatcgtgctgggcctggtgctgggcggcatcgtctgg
gcggccgaccacatcgcgtccttcacactgacgcccaccgtcttcttcttctacctgctg
ccccccatcgtgctggacgccggctacttcatgcccaaccgcctcttcttcggcaacctg
gggaccatcctgttgtacgccgtcgtgggtaccgtgtggaacgcggccaccaccgggctg
tccctctacggcgtcttcctcagtgggctcatgggcgacctgcagattgggctgctggac
ttcctcctgtttggcagcctcatggcggctgtggacccggtggccgtcctggccgtgttt
gaggaggtccatgtcaacgaggtcctgttcatcatcgtcttcggggagtcgctgctgaac
gacgcagtcaccgtggttctgtacaatgtgtttgaatctttcgtggcgctgggaggtgac
aacgtgactggcgtggactgcgtgaagggcatagtgtccttcttcgtggtgagcctgggg
ggcacgctggtgggggtggtcttcgccttcctgctgtcgctggtgacgcgcttcaccaag
catgtgcgtatcatcgagcccggcttcgtgttcatcatctcctacctgtcctacctgacg
tccgagatgctgtcgctgtcggccatcctcgccatcaccttctgtggcatctgctgtcag
aagtatgtgaaggccaacatctcggagcagtcggccaccaccgtgcgctacaccatgaag
atgctggccagcagcgccgagaccatcatcttcatgttcctgggtatctcggccgtgaac
ccgttcatctggacctggaacacggccttcgtgctcctgacgctggtcttcatctccgtg
taccgggccatcggtgtggtcctgcagacctggcttctgaaccgctaccgcatggtgcag
ctggagcccattgaccaggtggtcctgtcctacgggggcctgcgcggggccgtggccttt
gccctggtggtgcttctggatggagacaaggtcaaggagaagaacctgttcgtcagcacc
accatcatcgtagtgttcttcaccgtcatcttccagggcctgaccatcaagcctctggtg
cagtggctgaaggtgaagaggagcgagcaccgggaacctcggctcaacgagaagctgcac
gggcgcgctttcgaccacatcctctcggccatcgaggacatatccggacagatcgggcac
aattatctcagagacaagtggtcccacttcgacaggaagttcctcagcagggtcctcatg
agacggtcggcccagaagtctcgagaccggatcctgaatgtcttccacgagctgaacctg
aaggatgccatcagctacgtggctgagggagagcgccgcgggtccctggccttcatccgc
tcccccagcaccgacaacgtggtcaacgtggacttcacgccacgatcgtccaccgtggag
gcctctgtctcctacctcctgagagaaaatgtcagcgctgtctgcctggacatgcagtct
ctggagcagcgacggcggagcatccgggacgcggaggacatggtcacgcaccacacgcta
cagcagtacctgtacaagccgcggcaggagtacaagcatctgtacagccgacacgagctc
acgcccacggaggacgagaaacaggaccgggaaatcttccacaggaccatgcggaagcgc
ctggagtccttcaagtcgaccaagctggggctcaaccagaacaagaaggcggccaagctg
tacaagcgggagcgtgcccagaagcggagaaacagcagcatccccaatgggaagctgccc
atggagagccctgcgcagaatttcaccatcaaggagaaagacttggaactttcagacacc
gaggagccccccaactatgatgaggagatgagtggggggatcgagttcctggctagtgtc
accaaggacacagcgtccgactcccctgcaggaattgacaaccctgtgttttctccggac
gaggccctggaccgcagcctcctggccaggctgccgccctggctgtctcccggggagacg
gtggtcccctcgcagagggcccgcacgcagattccctactctcccggcaccttctgccgc
ctgatgcccttccgcctcagcagcaagtccgtggactccttcctgcaggcagacggcccc
gaggagcggccccccgccgccctccccgagtccacacacatgtga

DBGET integrated database retrieval system