KEGG   Homo sapiens (human): 6554Help
Entry
6554              CDS       T01001                                 

Gene name
SLC10A1, NTCP
Definition
solute carrier family 10 (sodium/bile acid cotransporter), member 1
Orthology
K14341  
solute carrier family 10 (sodium/bile acid cotransporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    6554 (SLC10A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
14q24.1
AA seq 349 aa AA seqDB search
MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKG
LAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSI
VMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKR
PQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVL
SALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLL
IAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaggcccacaacgcgtctgccccattcaacttcaccctgccacccaactttggcaag
cgccccacagacctggcactgagcgtcatcctggtgttcatgttgttcttcatcatgctc
tcgctgggctgcaccatggagttcagcaagatcaaggctcacttatggaagcctaaaggg
ctggccatcgccctggtggcacagtatggcatcatgcccctcacggcctttgtgctgggc
aaggtcttccggctgaagaacattgaggcactggccatcttggtctgtggctgctcacct
ggagggaacctgtccaatgtcttcagtctggccatgaagggggacatgaacctcagcatt
gtgatgaccacctgctccaccttctgtgcccttggcatgatgcctctcctcctgtacatc
tactccagggggatctatgatggggacctgaaggacaaggtgccctataaaggcatcgtg
atatcactggtcctggttctcattccttgcaccatagggatcgtcctcaaatccaaacgg
ccacaatacatgcgctatgtcatcaagggagggatgatcatcattctcttgtgcagtgtg
gccgtcacagttctctctgccatcaatgtggggaagagcatcatgtttgccatgacacca
ctcttgattgccacctcctccctgatgccttttattggctttctgctgggttatgttctc
tctgctctcttctgcctcaatggacggtgcagacgcactgtcagcatggagactggatgc
caaaatgtccaactctgttccaccatcctcaatgtggcctttccacctgaagtcattgga
ccacttttcttctttcccctcctctacatgattttccagcttggagaagggcttctcctc
attgccatattttggtgctatgagaaattcaagactcccaaggataaaacaaaaatgatc
tacacagctgccacaactgaagaaacaattccaggagctctgggaaatggcacctacaaa
ggggaggactgctccccttgcacagcctag

DBGET integrated database retrieval system