KEGG   Homo sapiens (human): 6554Help
Entry
6554              CDS       T01001                                 

Gene name
SLC10A1, NTCP
Definition
(RefSeq) solute carrier family 10 member 1
  KO
K14341  solute carrier family 10 (sodium/bile acid cotransporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
Drug target
Maralixibat (DG02832): D10951 D10952
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    6554 (SLC10A1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC10: Sodium bile salt cotransporter
   6554 (SLC10A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SBF SBF_like GAPT Mem_trans DUF2427
Motif
Other DBs
NCBI-GeneID: 6554
NCBI-ProteinID: NP_003040
OMIM: 182396
HGNC: 10905
Ensembl: ENSG00000100652
Vega: OTTHUMG00000171236
Pharos: Q14973(Tchem)
UniProt: Q14973 B2RA41
Position
14q24.1
AA seq 349 aa AA seqDB search
MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKG
LAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSI
VMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKR
PQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVL
SALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLL
IAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaggcccacaacgcgtctgccccattcaacttcaccctgccacccaactttggcaag
cgccccacagacctggcactgagcgtcatcctggtgttcatgttgttcttcatcatgctc
tcgctgggctgcaccatggagttcagcaagatcaaggctcacttatggaagcctaaaggg
ctggccatcgccctggtggcacagtatggcatcatgcccctcacggcctttgtgctgggc
aaggtcttccggctgaagaacattgaggcactggccatcttggtctgtggctgctcacct
ggagggaacctgtccaatgtcttcagtctggccatgaagggggacatgaacctcagcatt
gtgatgaccacctgctccaccttctgtgcccttggcatgatgcctctcctcctgtacatc
tactccagggggatctatgatggggacctgaaggacaaggtgccctataaaggcatcgtg
atatcactggtcctggttctcattccttgcaccatagggatcgtcctcaaatccaaacgg
ccacaatacatgcgctatgtcatcaagggagggatgatcatcattctcttgtgcagtgtg
gccgtcacagttctctctgccatcaatgtggggaagagcatcatgtttgccatgacacca
ctcttgattgccacctcctccctgatgccttttattggctttctgctgggttatgttctc
tctgctctcttctgcctcaatggacggtgcagacgcactgtcagcatggagactggatgc
caaaatgtccaactctgttccaccatcctcaatgtggcctttccacctgaagtcattgga
ccacttttcttctttcccctcctctacatgattttccagcttggagaagggcttctcctc
attgccatattttggtgctatgagaaattcaagactcccaaggataaaacaaaaatgatc
tacacagctgccacaactgaagaaacaattccaggagctctgggaaatggcacctacaaa
ggggaggactgctccccttgcacagcctag

DBGET integrated database retrieval system