KEGG   Homo sapiens (human): 6555Help
Entry
6555              CDS       T01001                                 

Gene name
SLC10A2, ASBT, IBAT, ISBT, NTCP2, PBAM
Definition
solute carrier family 10 (sodium/bile acid cotransporter), member 2
Orthology
K14342  
solute carrier family 10 (sodium/bile acid cotransporter), member 2
Organism
hsa  Homo sapiens (human)
Pathway
Bile secretion
Disease
H01016  
Primary bile acid malabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    6555 (SLC10A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q33
AA seq 348 aa AA seqDB search
MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLG
HIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVD
GDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVALVVPVSIGM
FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIAPKLWIIGTIFPVAGYSL
GFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF
AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatccgaacagctgtgtggacaatgcaacagtttgctctggtgcatcctgtgtg
gtacctgagagcaatttcaataacatcctaagtgtggtcctaagtacggtgctgaccatc
ctgttggccttggtgatgttctccatgggatgcaacgtggaaatcaagaaatttctaggg
cacataaagcggccgtggggcatttgtgttggcttcctctgtcagtttggaatcatgccc
ctcacaggattcatcctgtcggtggcctttgacatcctcccgctccaggccgtagtggtg
ctcattataggatgctgccctggaggaactgcctccaatatcttggcctattgggtcgat
ggcgacatggacctgagcgtcagcatgaccacatgctccacactgcttgccctcggaatg
atgccgctgtgcctccttatctataccaaaatgtgggtcgactctgggagcatcgtaatt
ccctatgataacataggtacatctctggttgctctcgttgttcctgtttccattggaatg
tttgttaatcacaaatggccccaaaaagcaaagatcatacttaaaattgggtccatcgcg
ggcgccatcctcattgtgctcatagctgtggttggaggaatattgtaccaaagcgcctgg
atcattgctcccaaactgtggattataggaacaatatttcctgtggcgggttactccctg
gggtttcttctggctagaattgctggtctaccctggtacaggtgccgaacggttgctttt
gaaacggggatgcagaacacgcagctatgttccaccatcgttcagctctccttcactcct
gaggagctcaatgtcgtattcaccttcccgctcatctacagcattttccagctcgccttt
gccgcaatattcttaggattttatgtggcatacaagaaatgtcatggaaaaaacaaggca
gaaattccagagagcaaagaaaatggaacggagccagagtcatcgttttataaggcaaat
ggaggatttcaacctgacgaaaagtag

DBGET integrated database retrieval system