KEGG   Homo sapiens (human): 6559Help
Entry
6559              CDS       T01001                                 

Gene name
SLC12A3, NCC, NCCT, TSC
Definition
solute carrier family 12 (sodium/chloride transporter), member 3
Orthology
K14426  
solute carrier family 12 (sodium/chloride transporter), member 3
Organism
hsa  Homo sapiens (human)
Disease
H00240  
Gitelman syndrome
Drug target
Bendroflumethiazide: 
Hydroflumethiazide: 
Hydrochlorothiazide: 
Chlorothiazide: 
Polythiazide: 
Trichlormethiazide: 
Methyclothiazide: 
Quinethazone: 
Chlortalidone: 
Mefruside: 
Metolazone: 
Meticrane: 
Indapamide: 
Other: 
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6559 (SLC12A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q13
AA seq 1030 aa AA seqDB search
MAELPTTETPGDATLCSGRFTISTLLSSDEPSPPAAYDSSHPSHLTHSSTFCMRTFGYNT
IDVVPTYEHYANSTQPGEPRKVRPTLADLHSFLKQEGRHLHALAFDSRPSHEMTDGLVEG
EAGTSSEKNPEEPVRFGWVKGVMIRCMLNIWGVILYLRLPWITAQAGIVLTWIIILLSVT
VTSITGLSISAISTNGKVKSGGTYFLISRSLGPELGGSIGLIFAFANAVGVAMHTVGFAE
TVRDLLQEYGAPIVDPINDIRIIGVVSVTVLLAISLAGMEWESKAQVLFFLVIMVSFANY
LVGTLIPPSEDKASKGFFSYRADIFVQNLVPDWRGPDGTFFGMFSIFFPSATGILAGANI
SGDLKDPAIAIPKGTLMAIFWTTISYLAISATIGSCVVRDASGVLNDTVTPGWGACEGLA
CSYGWNFTECTQQHSCHYGLINYYQTMSMVSGFAPLITAGIFGATLSSALACLVSAAKVF
QCLCEDQLYPLIGFFGKGYGKNKEPVRGYLLAYAIAVAFIIIAELNTIAPIISNFFLCSY
ALINFSCFHASITNSPGWRPSFQYYNKWAALFGAIISVVIMFLLTWWAALIAIGVVLFLL
LYVIYKKPEVNWGSSVQAGSYNLALSYSVGLNEVEDHIKNYRPQCLVLTGPPNFRPALVD
FVGTFTRNLSLMICGHVLIGPHKQRMPELQLIANGHTKWLNKRKIKAFYSDVIAEDLRRG
VQILMQAAGLGRMKPNILVVGFKKNWQSAHPATVEDYIGILHDAFDFNYGVCVMRMREGL
NVSKMMQAHINPVFDPAEDGKEASARGARPSVSGALDPKALVKEEQATTIFQSEQGKKTI
DIYWLFDDGGLTLLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFH
EVHILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISDEEITKNRV
KSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSSLYMAWLETLSQDLRPPVILIRGN
QENVLTFYCQ
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atggcagaactgcccacaacagagacgcctggggacgccactttgtgcagcgggcgcttc
accatcagcacactgctgagcagtgatgagccctctccaccagctgcctatgacagcagc
caccccagccacctgacccacagcagcaccttctgcatgcgcacctttggctacaacacg
atcgatgtggtgcccacatatgagcactatgccaacagcacccagcctggtgagccccgg
aaggtccggcccacactggctgacctgcactccttcctcaagcaggaaggcagacacctg
catgccctggcctttgacagccggcccagccacgagatgactgatgggctggtggagggc
gaggcaggcaccagcagcgagaagaaccccgaggagccagtgcgcttcggctgggtcaag
ggggtgatgattcgttgcatgctcaacatttggggcgtgatcctctacctgcggctgccc
tggattacggcccaggcaggcatcgtcctgacctggatcatcatcctgctgtcggtcacg
gtgacctccatcacaggcctctccatctcagccatctccaccaatggcaaggtcaagtca
ggtggcacctacttcctcatctcccggagtctgggcccagagcttgggggctccatcggc
ctcattttcgctttcgccaatgccgtgggtgtggccatgcacacggtgggctttgcagag
accgtgcgggacctgctccaggagtatggggcacccatcgtggaccccattaacgacatc
cgcatcattggcgtggtctcggtcactgtgctgctggccatctccctggctggcatggag
tgggagtccaaggcccaggtgctgttcttccttgtcatcatggtctcctttgccaactat
ttagtggggacgctgatccccccatctgaggacaaggcctccaaaggcttcttcagctac
cgggcggacatttttgtccagaacttggtgcctgactggcggggtccagatggcaccttc
ttcggaatgttctccatcttcttcccctcggccacaggcatcctggcaggggccaacata
tctggtgacctcaaggaccctgctatagccatccccaaggggaccctcatggccattttc
tggacgaccatttcctacctggccatctcagccaccattggctcctgcgtggtgcgtgat
gcctctggggtcctgaatgacacagtgacccctggctggggtgcctgcgaggggctggcc
tgcagctatggctggaacttcaccgagtgcacccagcagcacagctgccactacggcctc
atcaactattaccagaccatgagcatggtgtcaggcttcgcgcccctgatcacggctggc
atcttcggggccaccctctcctctgccctggcctgccttgtctctgctgccaaagtcttc
cagtgcctttgcgaggaccagctgtacccactgatcggcttcttcggcaaaggctatggc
aagaacaaggagcccgtgcgtggctacctgctggcctacgccatcgctgtggccttcatc
atcatcgctgagctcaacaccatagcccccatcatttccaacttcttcctctgctcctat
gccctcatcaacttcagctgcttccacgcctccatcaccaactcgcctgggtggagacct
tcattccaatactacaacaagtgggcggcgctgtttggggctatcatctccgtggtcatc
atgttcctcctcacctggtgggcggccctcatcgccattggcgtggtgctcttcctcctg
ctctatgtcatctacaagaagccagaggtaaattggggctcctcggtacaggctggctcc
tacaacctggccctcagctactcggtgggcctcaatgaggtggaagaccacatcaagaac
taccgcccccagtgcctggtgctcacggggccccccaacttccgcccggccctggtggac
tttgtgggcaccttcacccggaacctcagcctgatgatctgtggccacgtgctcatcgga
ccccacaagcagaggatgcctgagctccagctcatcgccaacgggcacaccaagtggctg
aacaagaggaagatcaaggccttctactcggatgtcattgccgaggacctccgcagaggc
gtccagatcctcatgcaggccgcaggtctcgggagaatgaagcccaacattctggtggtt
gggttcaagaagaactggcagtcggctcacccggccacagtggaagactacattggcatc
ctccatgatgcctttgatttcaactatggcgtgtgtgtcatgaggatgcgggagggactc
aacgtgtccaagatgatgcaggcgcacattaaccccgtgtttgacccagcggaggacggg
aaggaagccagcgccagaggtgccaggccatcagtctctggcgctttggaccccaaggcc
ctggtgaaggaggagcaggccaccaccatcttccagtcggagcagggcaagaagaccata
gacatctactggctctttgacgatggaggcctcaccctcctcattccctatctccttggc
cgcaagaggaggtggagcaaatgcaagatccgtgtgttcgtaggcggccagattaacagg
atggaccaggagagaaaggcgatcatttctctgctgagcaagttccgactgggattccat
gaagtccacatcctccctgacatcaaccagaaccctcgggctgagcacaccaagaggttt
gaggacatgattgcacccttccgtctgaatgatggcttcaaggatgaggccactgtcaac
gagatgcggcgggactgcccctggaagatctcagatgaggagattacgaagaacagagtc
aagtcccttcggcaggtgaggctgaatgagattgtgctggattactcccgagacgctgct
ctcatcgtcatcactttgcccatagggaggaaggggaagtgccccagctcgctgtacatg
gcctggctggagaccctgtcccaggacctcagacctccagtcatcctgatccgaggaaac
caggaaaacgtgctcaccttttactgccagtaa

DBGET integrated database retrieval system