KEGG   Homo sapiens (human): 6563Help
Entry
6563              CDS       T01001                                 

Gene name
SLC14A1, HUT11, HsT1341, JK, RACH1, RACH2, UT-B1, UT1, UTE
Definition
(RefSeq) solute carrier family 14 member 1 (Kidd blood group)
  KO
K08716  
solute carrier family 14 (urea transporter)
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC14: Urea transporter
   6563 (SLC14A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q12.3
AA seq 389 aa AA seqDB search
MEDSPTMVRVDSPTMVRGENQVSPCQGRRCFPKALGYVTGDMKELANQLKDKPVVLQFID
WILRGISQVVFVNNPVSGILILVGLLVQNPWWALTGWLGTVVSTLMALLLSQDRSLIASG
LYGYNATLVGVLMAVFSDKGDYFWWLLLPVCAMSMTCPIFSSALNSMLSKWDLPVFTLPF
NMALSMYLSATGHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQIYGCDNPW
TGGIFLGAILLSSPLMCLHAAIGSLLGIAAGLSLSAPFEDIYFGLWGFNSSLACIAMGGM
FMALTWQTHLLALGCALFTAYLGVGMANFMAEVGLPACTWPFCLATLLFLIMTTKNSNIY
KMPLSKVTYPEENRIFYLQAKKRMVESPL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaggacagccccactatggttagagtggacagccccactatggttaggggtgaaaac
caggtttcgccatgtcaagggagaaggtgcttccccaaagctcttggctatgtcaccggt
gacatgaaagaacttgccaaccagcttaaagacaaacccgtggtgctccagttcattgac
tggattctccggggcatatcccaagtggtgttcgtcaacaaccccgtcagtggaatcctg
attctggtaggacttcttgttcagaacccctggtgggctctcactggctggctgggaaca
gtggtctccactctgatggccctcttgctcagccaggacaggtcattaatagcatctggg
ctctatggctacaatgccaccctggtgggagtactcatggctgtcttttcggacaaggga
gactatttctggtggctgttactccctgtatgtgctatgtccatgacttgcccaattttc
tcaagtgcattgaattccatgctcagcaaatgggacctccccgtcttcaccctccctttc
aacatggcgttgtcaatgtacctttcagccacaggacattacaatccattctttccagcc
aaactggtcatacctataactacagctccaaatatctcctggtctgacctcagtgccctg
gagttgttgaaatctataccagtgggagttggtcagatctatggctgtgataatccatgg
acagggggcattttcctgggagccatcctactctcctccccactcatgtgcctgcatgct
gccataggatcattgctgggcatagcagcgggactcagtctttcagccccatttgaggac
atctactttggactctggggtttcaacagctctctggcctgcattgcaatgggaggaatg
ttcatggcgctcacctggcaaacccacctcctggctcttggctgtgccctgttcacggcc
tatcttggagtcggcatggcaaactttatggctgaggttggattgccagcttgtacctgg
cccttctgtttggccacgctattgttcctcatcatgaccacaaaaaattccaacatctac
aagatgcccctcagtaaagttacttatcctgaagaaaaccgcatcttctacctgcaagcc
aagaaaagaatggtggaaagccctttgtga

DBGET integrated database retrieval system