KEGG   Homo sapiens (human): 6564Help
Entry
6564              CDS       T01001                                 

Gene name
SLC15A1, HPECT1, HPEPT1, PEPT1
Definition
solute carrier family 15 (oligopeptide transporter), member 1
Orthology
K14206  
solute carrier family 15 (oligopeptide transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Class
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q32.3
AA seq 708 aa AA seqDB search
MGMSKSHSFFGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFV
ALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPV
HVVLSLIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTII
TPMLRVQQCGIHSKQACYPLAFGVPAALMAVALIVFVLGSGMYKKFKPQGNIMGKVAKCI
GFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTRVMFLYIPLPMFWALFDQQ
GSRWTLQATTMSGKIGALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAKCGFNFTSLKK
MAVGMVLASMAFVVAAIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGP
MSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQK
PEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQ
PNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVNMALQIPQYFLLTCGEVVFSV
TGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVC
VIFAIMARFYTYINPAEIEAQFDEDEKKNRLEKSNPYFMSGANSQKQM
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgggaatgtccaaatcacacagtttctttggttatcccctgagcatcttcttcatcgtg
gtcaatgagttttgcgaaagattttcctactatggaatgcgagcaatcctgattctgtac
ttcacaaatttcatcagctgggatgataacctgtccaccgccatctaccatacgtttgtg
gctctgtgctacctgacgccaattctcggagctcttatcgccgactcgtggctgggaaag
ttcaagaccattgtgtcgctctccattgtctacacaattggacaagcagtcacctcagta
agctccattaatgacctcacagaccacaaccatgatggcacccccgacagccttcctgtg
cacgtggtgctgtccttgatcggcctggccctgatagctctcgggactggaggaatcaaa
ccctgtgtgtctgcgtttggtggagatcagtttgaagagggccaggagaaacaaagaaac
agatttttttccatcttttacttggctattaatgctggaagtttgctttccacaatcatc
acacccatgctcagagttcaacaatgtggaattcacagtaaacaagcttgttacccactg
gcctttggggttcctgctgctctcatggctgtagccctgattgtgtttgtccttggcagt
gggatgtacaagaagttcaagccacagggcaacatcatgggtaaagtggccaagtgcatc
ggttttgccatcaaaaatagatttaggcatcggagtaaggcatttcccaagagggagcac
tggctggactgggctaaagagaaatacgatgagcggctcatctcccaaattaagatggtt
acgagggtgatgttcctgtatattccactcccaatgttctgggccttgtttgaccagcag
ggctccaggtggacactgcaggcaacaactatgtccgggaaaatcggagctcttgaaatt
cagcccgatcagatgcagaccgtgaacgccatcctgatcgtgatcatggtcccgatcttc
gatgctgtgctgtaccctctcattgcaaaatgtggcttcaatttcacctccttgaagaag
atggcagttggcatggtcctggcctccatggcctttgtggtggctgccatcgtgcaggtg
gaaatcgataaaactcttccagtcttccccaaaggaaacgaagtccaaattaaagttttg
aatataggaaacaataccatgaatatatctcttcctggagagatggtgacacttggccca
atgtctcaaacaaatgcatttatgacttttgatgtaaacaaactgacaaggataaacatt
tcttctcctggatcaccagtcactgctgtaactgacgacttcaagcagggccaacgccac
acgcttctagtgtgggcccccaatcactaccaggtggtaaaggatggtcttaaccagaag
ccagaaaaaggggaaaatggaatcagatttgtaaatacttttaacgagctcatcaccatc
acaatgagtgggaaagtttatgcaaacatcagcagctacaatgccagcacataccagttt
tttccttctggcataaaaggcttcacaataagctcaacagagattccgccacaatgtcaa
cctaatttcaatactttctaccttgaatttggtagtgcttatacctatatagtccaaagg
aagaatgacagctgccctgaagtgaaggtgtttgaagatatttcagccaacacagttaac
atggctctgcaaatcccgcagtattttcttctcacctgtggcgaagtggtcttctctgtc
acgggattggaattctcatattctcaggctccttccaacatgaagtcggtgcttcaggca
ggatggctgctgaccgtggctgttggcaacatcattgtgctcatcgtggcaggggcaggc
cagttcagcaaacagtgggccgagtacattctatttgccgcgttgcttctggtcgtctgt
gtaatttttgccatcatggctcggttctatacttacatcaacccagcggagatcgaagct
caatttgatgaggatgaaaagaaaaacagactggaaaagagtaacccatatttcatgtca
ggggccaattcacagaaacagatgtga

DBGET integrated database retrieval system