KEGG   Homo sapiens (human): 6564Help
Entry
6564              CDS       T01001                                 

Gene name
SLC15A1, HPECT1, HPEPT1, PEPT1
Definition
(RefSeq) solute carrier family 15 member 1
  KO
K14206  solute carrier family 15 (oligopeptide transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    6564 (SLC15A1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC15: Proton oligopeptide cotransporter
   6564 (SLC15A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTR2 MFS_2 AlgF DUF3742
Motif
Other DBs
NCBI-GeneID: 6564
NCBI-ProteinID: NP_005064
OMIM: 600544
HGNC: 10920
Ensembl: ENSG00000088386
Vega: OTTHUMG00000017255
Pharos: P46059(Tchem)
UniProt: P46059 B2CQT6
Position
13q32.2-q32.3
AA seq 708 aa AA seqDB search
MGMSKSHSFFGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFV
ALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPV
HVVLSLIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTII
TPMLRVQQCGIHSKQACYPLAFGVPAALMAVALIVFVLGSGMYKKFKPQGNIMGKVAKCI
GFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTRVMFLYIPLPMFWALFDQQ
GSRWTLQATTMSGKIGALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAKCGFNFTSLKK
MAVGMVLASMAFVVAAIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGP
MSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQK
PEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQ
PNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVNMALQIPQYFLLTCGEVVFSV
TGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVC
VIFAIMARFYTYINPAEIEAQFDEDEKKNRLEKSNPYFMSGANSQKQM
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgggaatgtccaaatcacacagtttctttggttatcccctgagcatcttcttcatcgtg
gtcaatgagttttgcgaaagattttcctactatggaatgcgagcaatcctgattctgtac
ttcacaaatttcatcagctgggatgataacctgtccaccgccatctaccatacgtttgtg
gctctgtgctacctgacgccaattctcggagctcttatcgccgactcgtggctgggaaag
ttcaagaccattgtgtcgctctccattgtctacacaattggacaagcagtcacctcagta
agctccattaatgacctcacagaccacaaccatgatggcacccccgacagccttcctgtg
cacgtggtgctgtccttgatcggcctggccctgatagctctcgggactggaggaatcaaa
ccctgtgtgtctgcgtttggtggagatcagtttgaagagggccaggagaaacaaagaaac
agatttttttccatcttttacttggctattaatgctggaagtttgctttccacaatcatc
acacccatgctcagagttcaacaatgtggaattcacagtaaacaagcttgttacccactg
gcctttggggttcctgctgctctcatggctgtagccctgattgtgtttgtccttggcagt
gggatgtacaagaagttcaagccacagggcaacatcatgggtaaagtggccaagtgcatc
ggttttgccatcaaaaatagatttaggcatcggagtaaggcatttcccaagagggagcac
tggctggactgggctaaagagaaatacgatgagcggctcatctcccaaattaagatggtt
acgagggtgatgttcctgtatattccactcccaatgttctgggccttgtttgaccagcag
ggctccaggtggacactgcaggcaacaactatgtccgggaaaatcggagctcttgaaatt
cagcccgatcagatgcagaccgtgaacgccatcctgatcgtgatcatggtcccgatcttc
gatgctgtgctgtaccctctcattgcaaaatgtggcttcaatttcacctccttgaagaag
atggcagttggcatggtcctggcctccatggcctttgtggtggctgccatcgtgcaggtg
gaaatcgataaaactcttccagtcttccccaaaggaaacgaagtccaaattaaagttttg
aatataggaaacaataccatgaatatatctcttcctggagagatggtgacacttggccca
atgtctcaaacaaatgcatttatgacttttgatgtaaacaaactgacaaggataaacatt
tcttctcctggatcaccagtcactgctgtaactgacgacttcaagcagggccaacgccac
acgcttctagtgtgggcccccaatcactaccaggtggtaaaggatggtcttaaccagaag
ccagaaaaaggggaaaatggaatcagatttgtaaatacttttaacgagctcatcaccatc
acaatgagtgggaaagtttatgcaaacatcagcagctacaatgccagcacataccagttt
tttccttctggcataaaaggcttcacaataagctcaacagagattccgccacaatgtcaa
cctaatttcaatactttctaccttgaatttggtagtgcttatacctatatagtccaaagg
aagaatgacagctgccctgaagtgaaggtgtttgaagatatttcagccaacacagttaac
atggctctgcaaatcccgcagtattttcttctcacctgtggcgaagtggtcttctctgtc
acgggattggaattctcatattctcaggctccttccaacatgaagtcggtgcttcaggca
ggatggctgctgaccgtggctgttggcaacatcattgtgctcatcgtggcaggggcaggc
cagttcagcaaacagtgggccgagtacattctatttgccgcgttgcttctggtcgtctgt
gtaatttttgccatcatggctcggttctatacttacatcaacccagcggagatcgaagct
caatttgatgaggatgaaaagaaaaacagactggaaaagagtaacccatatttcatgtca
ggggccaattcacagaaacagatgtga

DBGET integrated database retrieval system