KEGG   Homo sapiens (human): 657Help
Entry
657               CDS       T01001                                 

Gene name
BMPR1A, 10q23del, ACVRLK3, ALK3, CD292, SKR5
Definition
bone morphogenetic protein receptor, type IA (EC:2.7.11.30)
Orthology
K04673  
bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Hippo signaling pathway
Disease
H01023  
Juvenile polyposis syndrome
H01024  
Hereditary mixed polyposis syndrome
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q22.3
AA seq 532 aa AA seqDB search
MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLK
CYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRR
TIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYC
KSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAH
RDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKN
HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLR
PIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagctatacatttacatcagattattgggagcctatttgttcatcatttctcgt
gttcaaggacagaatctggatagtatgcttcatggcactgggatgaaatcagactccgac
cagaaaaagtcagaaaatggagtaaccttagcaccagaggataccttgccttttttaaag
tgctattgctcagggcactgtccagatgatgctattaataacacatgcataactaatgga
cattgctttgccatcatagaagaagatgaccagggagaaaccacattagcttcagggtgt
atgaaatatgaaggatctgattttcagtgcaaagattctccaaaagcccagctacgccgg
acaatagaatgttgtcggaccaatttatgtaaccagtatttgcaacccacactgccccct
gttgtcataggtccgttttttgatggcagcattcgatggctggttttgctcatttctatg
gctgtctgcataattgctatgatcatcttctccagctgcttttgttacaaacattattgc
aagagcatctcaagcagacgtcgttacaatcgtgatttggaacaggatgaagcatttatt
ccagttggagaatcactaaaagaccttattgaccagtcacaaagttctggtagtgggtct
ggactacctttattggttcagcgaactattgccaaacagattcagatggtccggcaagtt
ggtaaaggccgatatggagaagtatggatgggcaaatggcgtggcgaaaaagtggcggtg
aaagtattctttaccactgaagaagccagctggtttcgagaaacagaaatctaccaaact
gtgctaatgcgccatgaaaacatacttggtttcatagcggcagacattaaaggtacaggt
tcctggactcagctctatttgattactgattaccatgaaaatggatctctctatgacttc
ctgaaatgtgctacactggacaccagagccctgcttaaattggcttattcagctgcctgt
ggtctgtgccacctgcacacagaaatttatggcacccaaggaaagcccgcaattgctcat
cgagacctaaagagcaaaaacatcctcatcaagaaaaatgggagttgctgcattgctgac
ctgggccttgctgttaaattcaacagtgacacaaatgaagttgatgtgcccttgaatacc
agggtgggcaccaaacgctacatggctcccgaagtgctggacgaaagcctgaacaaaaac
cacttccagccctacatcatggctgacatctacagcttcggcctaatcatttgggagatg
gctcgtcgttgtatcacaggagggatcgtggaagaataccaattgccatattacaacatg
gtaccgagtgatccgtcatacgaagatatgcgtgaggttgtgtgtgtcaaacgtttgcgg
ccaattgtgtctaatcggtggaacagtgatgaatgtctacgagcagttttgaagctaatg
tcagaatgctgggcccacaatccagcctccagactcacagcattgagaattaagaagacg
cttgccaagatggttgaatcccaagatgtaaaaatctga

DBGET integrated database retrieval system