KEGG   Homo sapiens (human): 6570Help
Entry
6570              CDS       T01001                                 

Gene name
SLC18A1, CGAT, VAT1, VMAT1
Definition
solute carrier family 18 (vesicular monoamine transporter), member 1
Orthology
K08155  
MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Serotonergic synapse
Dopaminergic synapse
Parkinson's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Drug target
Reserpine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    6570 (SLC18A1)
   04726 Serotonergic synapse
    6570 (SLC18A1)
   04721 Synaptic vesicle cycle
    6570 (SLC18A1)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    6570 (SLC18A1)
  Substance dependence
   05030 Cocaine addiction
    6570 (SLC18A1)
   05031 Amphetamine addiction
    6570 (SLC18A1)
   05034 Alcoholism
    6570 (SLC18A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p21.3
AA seq 525 aa AA seqDB search
MLRTILDAPQRLLKEGRASRQLVLVVVFVALLLDNMLFTVVVPIVPTFLYDMEFKEVNSS
LHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISA
HKNNCLQGTGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLS
TVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGL
LVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESAKGTPLFMLLKDP
YILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLA
NKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDL
RHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRS
PPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgctccggaccattctggatgctccccagcggttgctgaaggaggggagagcgtcccgg
cagctggtgctggtggtggtattcgtcgctttgctcctggacaacatgctgtttactgtg
gtggtgccaattgtgcccaccttcctatatgacatggagttcaaagaagtcaactcttct
ctgcacctcggccatgccggaagttccccacatgccctcgcctctcctgccttttccacc
atcttctccttcttcaacaacaacaccgtggctgttgaagaaagcgtacctagtggaata
gcatggatgaatgacactgccagcaccatcccacctccagccactgaagccatctcagct
cataaaaacaactgcttgcaaggcacaggtttcttggaggaagagattacccgggtcggg
gttctgtttgcttcaaaggctgtgatgcaacttctggtcaacccattcgtgggccctctc
accaacaggattggatatcatatccccatgtttgctggctttgttatcatgtttctctcc
acagttatgtttgctttttctgggacctatactctactctttgtggcccgaacccttcaa
ggcattggatcttcattttcatctgttgcaggtcttggaatgctggccagtgtctacact
gatgaccatgagagaggacgagccatgggaactgctctggggggcctggccttggggttg
ctggtgggagctccctttggaagtgtaatgtacgagtttgttgggaagtctgcacccttc
ctcatcctggccttcctggcactactggatggagcactccagctttgcatcctacagcct
tccaaagtctctcctgagagtgccaaggggactcccctctttatgcttctcaaagaccct
tacatcctggtggctgcagggtccatctgctttgccaacatgggggtggccatcctggag
cccacactgcccatctggatgatgcagaccatgtgctcccccaagtggcagctgggtcta
gctttcttgcctgccagtgtgtcctacctcattggcaccaacctctttggtgtgttggcc
aacaagatgggtcggtggctgtgttccctaatcgggatgctggtagtaggtaccagcttg
ctctgtgttcctctggctcacaatatttttggtctcattggccccaatgcagggcttggc
cttgccataggcatggtggattcttctatgatgcccatcatggggcacctggtggatcta
cgccacacctcggtgtatgggagtgtctacgccatcgctgatgtggctttttgcatgggc
tttgctataggtccatccaccggtggtgccattgtaaaggccatcggttttccctggctc
atggtcatcactggggtcatcaacatcgtctatgctccactctgctactacctgcggagc
cccccggcaaaggaagagaagcttgctattctgagtcaggactgccccatggagacccgg
atgtatgcaacccagaagcccacgaaggaatttcctctgggggaggacagtgatgaggag
cctgaccatgaggagtag

DBGET integrated database retrieval system