KEGG   Homo sapiens (human): 6571Help
Entry
6571              CDS       T01001                                 

Gene name
SLC18A2, SVAT, SVMT, VAT2, VMAT2
Definition
solute carrier family 18 (vesicular monoamine transporter), member 2
Orthology
K08155  
MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Serotonergic synapse
Dopaminergic synapse
Parkinson's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Drug target
Reserpine: 
Tetrabenazine: 
Other: 
Class
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q25
AA seq 514 aa AA seqDB search
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEI
QTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSE
DKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSS
SYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGS
VLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGS
ICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLC
ALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGS
VYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKM
AILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggccctgagcgagctggcgctggtccgctggctgcaggagagccgccgctcgcggaag
ctcatcctgttcatcgtgttcctggcgctgctgctggacaacatgctgctcactgtcgtg
gtccccatcatcccaagttatctgtacagcattaagcatgagaagaatgctacagaaatc
cagacggccaggccagtgcacactgcctccatctcagacagcttccagagcatcttctcc
tattatgataactcgactatggtcaccgggaatgctaccagagacctgacacttcatcag
accgccacacagcacatggtgaccaacgcgtccgctgttccttccgactgtcccagtgaa
gacaaagacctcctgaatgaaaacgtgcaagttggtctgttgtttgcctcgaaagccacc
gtccagctcatcaccaaccctttcataggactactgaccaacagaattggctatccaatt
cccatatttgcgggattctgcatcatgtttgtctcaacaattatgtttgccttctccagc
agctatgccttcctgctgattgccaggtcgctgcagggcatcggctcgtcctgctcctct
gtggctgggatgggcatgcttgccagtgtctacacagatgatgaagagagaggcaacgtc
atgggaatcgccttgggaggcctggccatgggggtcttagtgggcccccccttcgggagt
gtgctctatgagtttgtggggaagacggctccgttcctggtgctggccgccctggtactc
ttggatggagctattcagctctttgtgctccagccgtcccgggtgcagccagagagtcag
aaggggacacccctaaccacgctgctgaaggacccgtacatcctcattgctgcaggctcc
atctgctttgcaaacatgggcatcgccatgctggagccagccctgcccatctggatgatg
gagaccatgtgttcccgaaagtggcagctgggcgttgccttcttgccagctagtatctct
tatctcattggaaccaatatttttgggatacttgcacacaaaatggggaggtggctttgt
gctcttctgggaatgataattgttggagtcagcattttatgtattccatttgcaaaaaac
atttatggactcatagctccgaactttggagttggttttgcaattggaatggtggattcg
tcaatgatgcctatcatgggctacctcgtagacctgcggcacgtgtccgtctatgggagt
gtgtacgccattgcggatgtggcattttgtatggggtatgctataggtccttctgctggt
ggtgctattgcaaaggcaattggatttccatggctcatgacaattattgggataattgat
attctttttgcccctctctgcttttttcttcgaagtccacctgccaaagaagaaaaaatg
gctattctcatggatcacaactgccctattaaaacaaaaatgtacactcagaataatatc
cagtcatatccgataggtgaagatgaagaatctgaaagtgactga

DBGET integrated database retrieval system