KEGG   Homo sapiens (human): 6571Help
Entry
6571              CDS       T01001                                 

Gene name
SLC18A2, SVAT, SVMT, VAT2, VMAT2
Definition
solute carrier family 18 (vesicular monoamine transporter), member 2
Orthology
K08155  
MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Serotonergic synapse
Dopaminergic synapse
Parkinson's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Drug target
Reserpine: 
Tetrabenazine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    6571 (SLC18A2)
   04726 Serotonergic synapse
    6571 (SLC18A2)
   04721 Synaptic vesicle cycle
    6571 (SLC18A2)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    6571 (SLC18A2)
  Substance dependence
   05030 Cocaine addiction
    6571 (SLC18A2)
   05031 Amphetamine addiction
    6571 (SLC18A2)
   05034 Alcoholism
    6571 (SLC18A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q25
AA seq 514 aa AA seqDB search
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEI
QTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSE
DKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSS
SYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGS
VLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGS
ICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLC
ALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGS
VYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKM
AILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggccctgagcgagctggcgctggtccgctggctgcaggagagccgccgctcgcggaag
ctcatcctgttcatcgtgttcctggcgctgctgctggacaacatgctgctcactgtcgtg
gtccccatcatcccaagttatctgtacagcattaagcatgagaagaatgctacagaaatc
cagacggccaggccagtgcacactgcctccatctcagacagcttccagagcatcttctcc
tattatgataactcgactatggtcaccgggaatgctaccagagacctgacacttcatcag
accgccacacagcacatggtgaccaacgcgtccgctgttccttccgactgtcccagtgaa
gacaaagacctcctgaatgaaaacgtgcaagttggtctgttgtttgcctcgaaagccacc
gtccagctcatcaccaaccctttcataggactactgaccaacagaattggctatccaatt
cccatatttgcgggattctgcatcatgtttgtctcaacaattatgtttgccttctccagc
agctatgccttcctgctgattgccaggtcgctgcagggcatcggctcgtcctgctcctct
gtggctgggatgggcatgcttgccagtgtctacacagatgatgaagagagaggcaacgtc
atgggaatcgccttgggaggcctggccatgggggtcttagtgggcccccccttcgggagt
gtgctctatgagtttgtggggaagacggctccgttcctggtgctggccgccctggtactc
ttggatggagctattcagctctttgtgctccagccgtcccgggtgcagccagagagtcag
aaggggacacccctaaccacgctgctgaaggacccgtacatcctcattgctgcaggctcc
atctgctttgcaaacatgggcatcgccatgctggagccagccctgcccatctggatgatg
gagaccatgtgttcccgaaagtggcagctgggcgttgccttcttgccagctagtatctct
tatctcattggaaccaatatttttgggatacttgcacacaaaatggggaggtggctttgt
gctcttctgggaatgataattgttggagtcagcattttatgtattccatttgcaaaaaac
atttatggactcatagctccgaactttggagttggttttgcaattggaatggtggattcg
tcaatgatgcctatcatgggctacctcgtagacctgcggcacgtgtccgtctatgggagt
gtgtacgccattgcggatgtggcattttgtatggggtatgctataggtccttctgctggt
ggtgctattgcaaaggcaattggatttccatggctcatgacaattattgggataattgat
attctttttgcccctctctgcttttttcttcgaagtccacctgccaaagaagaaaaaatg
gctattctcatggatcacaactgccctattaaaacaaaaatgtacactcagaataatatc
cagtcatatccgataggtgaagatgaagaatctgaaagtgactga

DBGET integrated database retrieval system