KEGG   Homo sapiens (human): 6572Help
Entry
6572              CDS       T01001                                 

Gene name
SLC18A3, VACHT
Definition
solute carrier family 18 (vesicular acetylcholine transporter), member 3
Orthology
K14636  
MFS transporter, DHA1 family, solute carrier family 18 (vesicular acetylcholine transporter), member 3
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    6572 (SLC18A3)
   04721 Synaptic vesicle cycle
    6572 (SLC18A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q11.2
AA seq 532 aa AA seqDB search
MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDY
IAHMRGGGEGPTRTPEVWEPTLPLPTPANASAYTANTSASPTAAWPAGSALRPRYPTESE
DVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVLFAFAEDYATLFA
ARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAG
KRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGTPIHRLMLDPYIAVVAGALTT
CNIPLAFLEPTIATWMKHTMAASEWEMGMAWLPAFVPHVLGVYLTVRLAARYPHLQWLYG
ALGLAVIGASSCIVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSV
YAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRS
ERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgcggaacctgcgggccaggcccgggcggcggccaccaagctgtcggaggct
gtgggcgcggcgctgcaggagccccggcggcagaggcgcctggtgcttgttatcgtgtgc
gtggcgctgttactggacaacatgctgtacatggtcatcgtgcccatagtgcccgactac
atcgcccacatgcgcgggggcggcgagggccccacccggactcccgaggtgtgggagccc
accctgccgctgcccactccggccaatgccagcgcctacacggccaacacctcggcgtcc
ccgacagctgcgtggccagcgggctcagcccttcggccccgctaccctacggagagcgaa
gacgtgaagatcggggtgctgtttgcttccaaggctatcctgcagctgctagtgaacccc
ttgagcgggcccttcatcgaccgcatgagctacgacgtgccgctgctgatcggcctgggc
gtcatgttcgcctctacagtcctgttcgccttcgccgaggactacgccacgctgttcgcg
gcgcgcagcctgcagggcctgggctcagccttcgccgacacgtctggcatagccatgatc
gccgataagtacccggaggagccggagcgcagtcgtgcactgggcgtggcgctggccttc
attagcttcggaagcctagtggccccgcccttcgggggcatcctctatgagttcgccggc
aagcgcgtgcccttcttggtgctagctgccgtgtcgctctttgacgcgctgttgctgctg
gcagtggccaaacccttctcggcggctgcacgggctcgggccaacctgccagtgggcact
cccatccaccgcctcatgctagacccctacattgccgtggtggccggcgcgctcaccacc
tgtaacattcccctcgccttcctcgaacccaccattgccacgtggatgaagcatacgatg
gcggcttccgagtgggagatgggcatggcctggctgccggccttcgtgcctcatgtgctg
ggcgtctacctcaccgtgcgcctggcggcgcgctacccacacctgcagtggctgtacggc
gcgcttgggctggctgtgatcggcgccagctcgtgcatcgtgcccgcctgccgctccttc
gcgccgctagtggtctcactatgcggcctctgttttggcatagccctagtcgacacagca
ctgctgcccacgctcgccttcctggtggacgtgcgccatgtctcagtctatggcagcgtc
tacgccatcgccgacatctcctattcggtggcctacgcgctcgggcccatagtggcaggc
cacattgtgcactcgctgggctttgagcagctcagccttggcatgggactggccaacctg
ctctatgctcccgtcttgctgctgctccgcaacgtgggcctcctgacgcgctcccgttcc
gagcgcgatgtgctgcttgatgagccaccgcaaggtctgtacgatgcggtgcgcctgcgt
gagcgtcctgtgtctggccaggacggcgagcctcgcagcccgcctggcccttttgatgcg
tgcgaggacgactacaactactactacacccgcagctag

DBGET integrated database retrieval system