KEGG   Homo sapiens (human): 6573Help
Entry
6573              CDS       T01001                                 

Gene name
SLC19A1, CHMD, FOLT, IFC1, REFC, RFC1
Definition
solute carrier family 19 (folate transporter), member 1
Orthology
K14609  
solute carrier family 19 (folate transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    6573 (SLC19A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.3
AA seq 489 aa AA seqDB search
MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITPYLLGPDKNFT
REQVTNEITPVLSYSYLAVLVPVFLLTDYLRYTPVLLLQGLSFVSVWLLLLLGHSVAHMQ
LMELFYSVTMAARIAYSSYIFSLVRPARYQRVAGYSRAAVLLGVFTSSVLGQLLVTVGRV
SFSTLNYISLAFLTFSVVLALFLKRPKRSLFFNRDDRGRCETSASELERMNPGPGGKLGH
ALRVACGDSVLARMLRELGDSLRRPQLRLWSLWWVFNSAGYYLVVYYVHILWNEVDPTTN
SARVYNGAADAASTLLGAITSFAAGFVKIRWARWSKLLIAGVTATQAGLVFLLAHTRHPS
SIWLCYAAFVLFRGSYQFLVPIATFQIASSLSKELCALVFGVNTFFATIVKTIITFIVSD
VRGLGLPVRKQNEELHVASLSLWKSHLRLAADTLSSEGSSGSGPRSWFLSPTLRAALHGP
VCPSEVCPS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggtgccctccagcccagcggtggagaagcaggtgcccgtggaacctgggcctgacccc
gagctccggtcctggcggcacctcgtgtgctacctttgcttctacggcttcatggcgcag
atacggccaggggagagcttcatcaccccctacctcctggggcccgacaagaacttcacg
cgggagcaggtcacgaacgagatcacgccggtgctgtcgtactcctacctggccgtgctg
gtgcccgtgttcctgctcaccgactacctgcgctacacgccggtgctgctgctgcagggg
ctcagcttcgtgtcggtgtggctgctgctgctgctgggccactcggtggcgcacatgcag
ctcatggagctcttctacagcgtcaccatggccgcgcgcatcgcctattcctcctacatc
ttctctctcgtgcggcccgcgcgctaccagcgtgtggccggctactcgcgcgctgcggtg
ctgctgggcgtgttcaccagctccgtgctgggccagctgctggtcactgtgggccgagtc
tccttctccacgctcaactacatctcgctggccttcctcaccttcagcgtggtcctcgcc
ctcttcctgaagcgccccaagcgcagcctcttcttcaaccgcgacgaccgggggcggtgc
gaaacctcggcttcggagctggagcgcatgaatcctggcccaggcgggaagctgggacac
gccctgcgggtggcctgtggggactcagtgctggcgcggatgctgcgggagctgggggac
agcctgcggcggccgcagctgcgcctgtggtccctctggtgggtcttcaactcggccggc
tactacctggtggtctactacgtgcacatcctgtggaacgaggtggaccccaccaccaac
agtgcgcgggtctacaacggcgcggcagatgctgcctccacgctgctgggcgccatcacg
tccttcgccgcgggcttcgtgaagatccgctgggcgcgctggtccaagctgctcatcgcg
ggcgtcacggccacgcaggcggggctggtcttccttctggcgcacacgcgccacccgagc
agcatctggctgtgctatgcggccttcgtgctgttccgcggctcctaccagttcctcgtg
cccatcgccacctttcagattgcatcttctctgtctaaagagctctgtgccctggtcttc
ggggtcaacacgttctttgccaccatcgtcaagaccatcatcactttcattgtctcggac
gtgcggggcctgggcctcccggtccgcaagcagaatgaagaactgcatgtggcttctctg
tctctgtggaaaagccatctcaggttggcggcagacacattgtcatcagaggggagcagc
ggctctggtcctcggagctggttcctctctcccaccctaagggcagccctccatggtcct
gtctgtccttctgaagtgtgtccatcctga

DBGET integrated database retrieval system