KEGG   Homo sapiens (human): 6574Help
Entry
6574              CDS       T01001                                 

Gene name
SLC20A1, GLVR1, Glvr-1, PIT1, PiT-1
Definition
(RefSeq) solute carrier family 20 member 1
  KO
K14640  
solute carrier family 20 (sodium-dependent phosphate transporter)
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC20: Type III Na+-phosphate cotransporter
   6574 (SLC20A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q13
AA seq 679 aa AA seqDB search
MATLITSTTAATAASGPLVDYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLK
QACILASIFETVGSVLLGAKVSETIRKGLIDVEMYNSTQGLLMAGSVSAMFGSAVWQLVA
SFLKLPISGTHCIVGATIGFSLVAKGQEGVKWSELIKIVMSWFVSPLLSGIMSGILFFLV
RAFILHKADPVPNGLRALPVFYACTVGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAV
FCALIVWFFVCPRMKRKIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSE
VGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPNGNLV
QFSQAVSNQINSSGHYQYHTVHKDSGLYKELLHKLHLAKVGDCMGDSGDKPLRRNNSYTS
YTMAICGMPLDSFRAKEGEQKGEEMEKLTWPNADSKKRIRMDSYTSYCNAVSDLHSASEI
DMSVKAEMGLGDRKGSNGSLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIG
PLVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGF
SIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPI
SGVISAAIMAIFRYVILRM
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgctgattaccagtactacagctgctaccgccgcttctggtcctttggtggac
tacctatggatgctcatcctgggcttcattattgcatttgtcttggcattctccgtggga
gccaatgatgtagcaaattcttttggtacagctgtgggctcaggtgtagtgaccctgaag
caagcctgcatcctagctagcatctttgaaacagtgggctctgtcttactgggggccaaa
gtgagcgaaaccatccggaagggcttgattgacgtggagatgtacaactcgactcaaggg
ctgctgatggccggctcagtcagtgctatgtttggttctgctgtgtggcaactcgtggct
tcgtttttgaagctccctatttctggaacccattgtattgttggtgcaactattggtttc
tccctcgtggcaaaggggcaggagggtgtcaagtggtctgaactgataaaaattgtgatg
tcttggttcgtgtccccactgctttctggaattatgtctggaattttattcttcctggtt
cgtgcattcatcctccataaggcagatccagttcctaatggtttgcgagctttgccagtt
ttctatgcctgcacagttggaataaacctcttttccatcatgtatactggagcaccgttg
ctgggctttgacaaacttcctctgtggggtaccatcctcatctcggtgggatgtgcagtt
ttctgtgcccttatcgtctggttctttgtatgtcccaggatgaagagaaaaattgaacga
gaaataaagtgtagtccttctgaaagccccttaatggaaaaaaagaatagcttgaaagaa
gaccatgaagaaacaaagttgtctgttggtgatattgaaaacaagcatcctgtttctgag
gtagggcctgccactgtgcccctccaggctgtggtggaggagagaacagtctcattcaaa
cttggagatttggaggaagctccagagagagagaggcttcccagcgtggacttgaaagag
gaaaccagcatagatagcaccgtgaatggtgcagtgcagttgcctaatgggaaccttgtc
cagttcagtcaagccgtcagcaaccaaataaactccagtggccactaccagtatcacacc
gtgcataaggattccggcctgtacaaagagctactccataaattacatcttgccaaggtg
ggagattgcatgggagactccggtgacaaacccttaaggcgcaataatagctatacttcc
tataccatggcaatatgtggcatgcctctggattcattccgtgccaaagaaggtgaacag
aagggcgaagaaatggagaagctgacatggcctaatgcagactccaagaagcgaattcga
atggacagttacaccagttactgcaatgctgtgtctgaccttcactcagcatctgagata
gacatgagtgtcaaggcagagatgggtctaggtgacagaaaaggaagtaatggctctcta
gaagaatggtatgaccaggataagcctgaagtctctctcctcttccagttcctgcagatc
cttacagcctgctttgggtcattcgcccatggtggcaatgacgtaagcaatgccattggg
cctctggttgctttatatttggtttatgacacaggagatgtttcttcaaaagtggcaaca
ccaatatggcttctactctatggtggtgttggtatctgtgttggtctgtgggtttgggga
agaagagttatccagaccatggggaaggatctgacaccgatcacaccctctagtggcttc
agtattgaactggcatctgccctcactgtggtgattgcatcaaatattggccttcccatc
agtacaacacattgtaaagtgggctctgttgtgtctgttggctggctccggtccaagaag
gctgttgactggcgtctctttcgtaacatttttatggcctggtttgtcacagtccccatt
tctggagttatcagtgctgccatcatggcaatcttcagatatgtcatcctcagaatgtga

DBGET integrated database retrieval system