KEGG   Homo sapiens (human): 6579Help
Entry
6579              CDS       T01001                                 

Gene name
SLCO1A2, OATP, OATP-A, OATP1A2, SLC21A3
Definition
solute carrier organic anion transporter family, member 1A2
Orthology
K03460  
solute carrier organic anion transporter family, member 1A
Organism
hsa  Homo sapiens (human)
Pathway
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    6579 (SLCO1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p12
AA seq 670 aa AA seqDB search
MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGF
INGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVS
VSGNLSSNSFLCMENGTQILRPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPLGI
SYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTR
WVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYG
ITKDFLPFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGI
YNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINT
SYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMV
FQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMK
SEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYI
YLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTV
LKDDELKTKL
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaactgagaaaagaattgaaacccatagaataagatgtctttccaagttgaag
atgtttctgttggcaataacatgtgcatttgtatccaaaacactgtctggatcttatatg
aattccatgctcacacaaatagagagacaattcaacatcccaacatctctagttggattc
attaatggaagctttgagattggaaatcttttgttgattatatttgtgagttattttgga
accaaactgcatagacctataatgattggcattggatgtgtggttatgggcttaggctgt
ttcttaaaatcactacctcatttcctcatgaaccaatatgaatatgaatctacagtttca
gtttcaggcaacttgtcctcaaacagtttcttgtgtatggaaaatggaacccagatttta
agaccaacgcaggatccatcagagtgtacaaaggaagttaaatcattaatgtgggtgtac
gtcctagtaggcaatattgtacgtggaatgggtgaaactcccatcctgcctttgggtatt
tcctatatagaagattttgccaaatttgaaaattctcctttatatattgggcttgtagaa
acaggagctattattggtcctttgattggacttttgttggcatcattctgtgcaaatgtt
tatgttgacactggatttgtgaacacagatgatctgatcataactcccactgacactcgt
tgggtcggtgcatggtggtttggctttctgatttgtgcaggagttaacgtgctcactgcc
attccttttttctttttgcccaacacacttccaaaggaaggactagagactaatgctgac
atcattaaaaatgaaaatgaagacaaacaaaaagaagaggtcaagaaggaaaaatatgga
atcactaaagattttctacctttcatgaaaagtctttcctgcaatccaatttatatgctt
ttcatacttgtaagtgtgatacagttcaatgcattcgttaacatgatctccttcatgcct
aaatacctagaacagcaatatggaatatcatcttcagatgcaatctttctaatgggtatt
tataacttacctccaatatgtattggatatataattggtggtttaattatgaagaagttc
aagattactgtcaaacaagctgcccacataggatgttggttatccttacttgagtatctt
ctctattttttatcttttctcatgacttgtgaaaattcttcagttgttggaataaatacc
tcttatgaaggaattccacaagatttatatgtggaaaatgacatctttgctgattgcaat
gtggattgcaactgtccatctaaaatatgggatcctgtgtgtggaaacaatggcttgtca
tatctgtcagcttgtcttgctggttgtgagacatccattggaacgggaataaacatggtg
ttccaaaattgcagctgtattcaaacatcaggaaattcatctgcagttcttgggctgtgc
gacaaaggacctgactgttccttgatgctccagtacttcctaatcttgtcagcgatgagc
agtttcatttattctttggctgccatacctggatatatggttctcttgaggtgtatgaaa
tctgaagagaagtcccttggtgtgggattacatacattttgcacaagagtatttgctggc
attcctgcacctatatattttggcgctttaatggattccacatgtttacactggggaact
ttgaaatgtggtgagtcaggggcatgcaggatatatgattccaccaccttcagatacatc
tacctcggattgccggcagcactaagaggatcaagctttgttccagccttaatcatctta
attcttttgaggaagtgtcatctacctggtgaaaatgcctcttcaggaacagagcttata
gagacaaaagtcaaagggaaggaaaatgagtgcaaagatatataccaaaagtccacggtt
ttgaaagatgatgaattgaaaactaaattgtaa

DBGET integrated database retrieval system