KEGG   Homo sapiens (human): 658Help
Entry
658               CDS       T01001                                 

Gene name
BMPR1B, ALK-6, ALK6, AMDD, BDA1D, BDA2, CDw293
Definition
(RefSeq) bone morphogenetic protein receptor type 1B (EC:2.7.11.30)
  KO
K13578  
bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Axon guidance
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Module
BMP signaling
Disease
H00468  
Acromesomelic dysplasia with genital anomalies
H00482  
Brachydactyly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    658 (BMPR1B)
   04390 Hippo signaling pathway
    658 (BMPR1B)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    658 (BMPR1B)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    658 (BMPR1B)
 Organismal Systems
  Development
   04360 Axon guidance
    658 (BMPR1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     658 (BMPR1B)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  TGFBR1 family [OT]
   658 (BMPR1B)
Enzyme-linked receptors [BR:hsa01020]
 Receptor serine/threonine kinases
  Type I TGF-beta receptor
   658 (BMPR1B)
Cytokine receptors [BR:hsa04050]
 TGF-beta receptors
  Type I TGF-beta receptor
   658 (BMPR1B)
Cellular antigens [BR:hsa04090]
 Proteins
  658 (BMPR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q22-q24
AA seq 502 aa AA seqDB search
MLLRSAGKLNVGTKKEDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEED
DSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVD
GPIHHRALLISVTVCSLLLVLIILFCYFRYKRQETRPRYSIGLEQDETYIPPGESLRDLI
EQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEAS
WFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKS
MLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFISD
TNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEVARRCVSGGIV
EEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPAS
RLTALRVKKTLAKMSESQDIKL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcttttgcgaagtgcaggaaaattaaatgtgggcaccaagaaagaggatggtgagagt
acagcccccaccccccgtccaaaggtcttgcgttgtaaatgccaccaccattgtccagaa
gactcagtcaacaatatttgcagcacagacggatattgtttcacgatgatagaagaggat
gactctgggttgcctgtggtcacttctggttgcctaggactagaaggctcagattttcag
tgtcgggacactcccattcctcatcaaagaagatcaattgaatgctgcacagaaaggaac
gaatgtaataaagacctacaccctacactgcctccattgaaaaacagagattttgttgat
ggacctatacaccacagggctttacttatatctgtgactgtctgtagtttgctcttggtc
cttatcatattattttgttacttccggtataaaagacaagaaaccagacctcgatacagc
attgggttagaacaggatgaaacttacattcctcctggagaatccctgagagacttaatt
gagcagtctcagagctcaggaagtggatcaggcctccctctgctggtccaaaggactata
gctaagcagattcagatggtgaaacagattggaaaaggtcgctatggggaagtttggatg
ggaaagtggcgtggcgaaaaggtagctgtgaaagtgttcttcaccacagaggaagccagc
tggttcagagagacagaaatatatcagacagtgttgatgaggcatgaaaacattttgggt
ttcattgctgcagatatcaaagggacagggtcctggacccagttgtacctaatcacagac
tatcatgaaaatggttccctttatgattatctgaagtccaccaccctagacgctaaatca
atgctgaagttagcctactcttctgtcagtggcttatgtcatttacacacagaaatcttt
agtactcaaggcaaaccagcaattgcccatcgagatctgaaaagtaaaaacattctggtg
aagaaaaatggaacttgctgtattgctgacctgggcctggctgttaaatttattagtgat
acaaatgaagttgacataccacctaacactcgagttggcaccaaacgctatatgcctcca
gaagtgttggacgagagcttgaacagaaatcacttccagtcttacatcatggctgacatg
tatagttttggcctcatcctttgggaggttgctaggagatgtgtatcaggaggtatagtg
gaagaataccagcttccttatcatgacctagtgcccagtgacccctcttatgaggacatg
agggagattgtgtgcatcaagaagttacgcccctcattcccaaaccggtggagcagtgat
gagtgtctaaggcagatgggaaaactcatgacagaatgctgggctcacaatcctgcatca
aggctgacagccctgcgggttaagaaaacacttgccaaaatgtcagagtcccaggacatt
aaactctga

DBGET integrated database retrieval system