KEGG   Homo sapiens (human): 6580Help
Entry
6580              CDS       T01001                                 

Gene name
SLC22A1, HOCT1, OCT1, oct1_cds
Definition
solute carrier family 22 (organic cation transporter), member 1
Orthology
K08198  
MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    6580 (SLC22A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q25.3
AA seq 554 aa AA seqDB search
MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQ
RCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGP
CQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLL
GTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
QMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIK
IMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVL
YQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVM
IFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
PFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKEN
TIYLKVQTSEPSGT
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgtggatgacattctggagcaggttggggagtctggctggttccagaagcaa
gccttcctcatcttatgcctgctgtcggctgcctttgcgcccatctgtgtgggcatcgtc
ttcctgggtttcacacctgaccaccactgccagagtcctggggtggctgagctgagccag
cgctgtggctggagccctgcggaggagctgaactatacagtgccaggcctggggcccgcg
ggcgaggccttccttggccagtgcaggcgctatgaagtggactggaaccagagcgccctc
agctgtgtagaccccctggctagcctggccaccaacaggagccacctgccgctgggtccc
tgccaggatggctgggtgtatgacacgcccggctcttccatcgtcactgagttcaacctg
gtgtgtgctgactcctggaagctggacctctttcagtcctgtttgaatgcgggcttcttg
tttggctctctcggtgttggctactttgcagacaggtttggccgtaagctgtgtctcctg
ggaactgtgctggtcaacgcggtgtcgggcgtgctcatggccttctcgcccaactacatg
tccatgctgctcttccgcctgctgcagggcctggtcagcaagggcaactggatggctggc
tacaccctaatcacagaatttgttggctcgggctccagaagaacggtggcgatcatgtac
cagatggccttcacggtggggctggtggcgcttaccgggctggcctacgccctgcctcac
tggcgctggctgcagctggcagtctccctgcccaccttcctcttcctgctctactactgg
tgtgtgccggagtcccctcggtggctgttatcacaaaaaagaaacactgaagcaataaag
ataatggaccacatcgctcaaaagaatgggaagttgcctcctgctgatttaaagatgctt
tccctcgaagaggatgtcaccgaaaagctgagcccttcatttgcagacctgttccgcacg
ccgcgcctgaggaagcgcaccttcatcctgatgtacctgtggttcacggactctgtgctc
tatcaggggctcatcctgcacatgggcgccaccagcgggaacctctacctggatttcctt
tactccgctctggtcgaaatcccgggggccttcatagccctcatcaccattgaccgcgtg
ggccgcatctaccccatggccatgtcaaatttgttggcgggggcagcctgcctcgtcatg
atttttatctcacctgacctgcactggttaaacatcataatcatgtgtgttggccgaatg
ggaatcaccattgcaatacaaatgatctgcctggtgaatgctgagctgtaccccacattc
gtcaggaacctcggagtgatggtgtgttcctccctgtgtgacataggtgggataatcacc
cccttcatagtcttcaggctgagggaggtctggcaagccttgcccctcattttgtttgcg
gtgttgggcctgcttgccgcgggagtgacgctacttcttccagagaccaagggggtcgct
ttgccagagaccatgaaggacgccgagaaccttgggagaaaagcaaagcccaaagaaaac
acgatttaccttaaggtccaaacctcagaaccctcgggcacctga

DBGET integrated database retrieval system