KEGG   Homo sapiens (human): 6582Help
Entry
6582              CDS       T01001                                 

Gene name
SLC22A2, OCT2
Definition
(RefSeq) solute carrier family 22 member 2
  KO
K08199  
MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 2
Organism
hsa  Homo sapiens (human)
Pathway
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    6582 (SLC22A2)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   6582 (SLC22A2)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    6582 (SLC22A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q25.3
AA seq 555 aa AA seqDB search
MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELS
LRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLG
PCRDGWVYETPGSSIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCL
LTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIF
YQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAEAM
RIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSV
LYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLA
SVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGII
TPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKE
KMIYLQVQKLDIPLN
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccaccgtggacgatgtcctggagcatggaggggagtttcactttttccagaag
caaatgtttttcctcttggctctgctctcggctaccttcgcgcccatctacgtgggcatc
gtcttcctgggcttcacccctgaccaccgctgccggagccccggagtggccgagctgagt
ctgcgctgcggctggagtcctgcagaggaactgaactacacggtgccgggcccaggacct
gcgggcgaagcctccccaagacagtgtaggcgctacgaggtggactggaaccagagcacc
ttcgactgcgtggaccccctggccagcctggacaccaacaggagccgcctgccactgggc
ccctgccgggacggctgggtgtacgagacgcctggctcgtccatcgtcaccgagtttaac
ctggtatgtgccaactcctggatgttggacctattccagtcatcagtgaatgtaggattc
tttattggctctatgagtatcggctacatagcagacaggtttggccgtaagctctgcctc
ctaactacagtcctcataaatgctgcagctggagttctcatggccatttccccaacctat
acgtggatgttaatttttcgcttaatccaaggactggtcagcaaagcaggctggttaata
ggctacatcctgattacagaatttgttgggcggagatatcggagaacagtggggattttt
taccaagttgcctatacagttgggctcctggtgctagctggggtggcttacgcacttcct
cactggaggtggttgcagttcacagtttctctgcccaacttcttcttcttgctctattac
tggtgcatacctgagtctcccaggtggctgatctcccagaataagaatgctgaagccatg
agaatcattaagcacatcgcaaagaaaaatggaaaatctctacccgcctcccttcagcgc
ctgagacttgaagaggaaactggcaagaaattgaacccttcatttcttgacttggtcaga
actcctcagataaggaaacatactatgatattgatgtacaactggttcacgagctctgtg
ctctaccagggcctcatcatgcacatgggccttgcaggtgacaatatctacctggatttc
ttctactctgccctggttgaattcccagctgccttcatgatcatcctcaccatcgaccgc
atcggacgccgttacccttgggctgcatcaaatatggttgcaggggcagcctgtctggcc
tcagtttttatacctggtgatctacaatggctaaaaattattatctcatgcttgggaaga
atggggatcacaatggcctatgagatagtctgcctggtcaatgctgagctgtaccccaca
ttcattaggaatcttggcgtccacatctgttcctcaatgtgtgacattggtggcatcatc
acgccattcctggtctaccggctcactaacatctggcttgagctcccgctgatggttttc
ggcgtgcttggcttggttgctggaggtctggtgctgttgcttccagaaactaaagggaaa
gctttgcctgagaccatcgaggaagccgaaaatatgcaaagaccaagaaaaaataaagaa
aagatgatttacctccaagttcagaaactagacattccattgaactaa

DBGET integrated database retrieval system