KEGG   Homo sapiens (human): 6585Help
Entry
6585              CDS       T01001                                 

Gene name
SLIT1, MEGF4, SLIL1, SLIT-1, SLIT3
Definition
slit homolog 1 (Drosophila)
Orthology
K06838  
slit 1
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Class
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q23.3-q24
AA seq 1534 aa AA seqDB search
MALTPGWGSSAGPVRPELWLLLWAAAWRLGASACPALCTCTGTTVDCHGTGLQAIPKNIP
RNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQ
LHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRAL
RGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFT
QCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSNGIVDCRGKGL
TAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLN
SLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSL
AKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSGARCASPRRLANKRIGQI
KSKKFRCSAKEQYFIPGTEDYQLNSECNSDVVCPHKCRCEANVVECSSLKLTKIPERIPQ
STAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQ
LESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTL
QSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCE
EGQEEGGCLPRPQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQFTLVPGQL
STFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLH
GNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPQDME
GKLLLTTPAKKFECQGPPTLAVQAKCDLCLSSPCQNQGTCHNDPLEVYRCACPSGYKGRD
CEVSLDSCSSGPCENGGTCHAQEGEDAPFTCSCPTGFEGPTCGVNTDDCVDHACANGGVC
VDGVGNYTCQCPLQYEGKACEQLVDLCSPDLNPCQHEAQCVGTPDGPRCECMPGYAGDNC
SENQDDCRDHRCQNGAQCMDEVNSYSCLCAEGYSGQLCEIPPHLPAPKSPCEGTECQNGA
NCVDQGNRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVSTAEDN
GILLYNGDNDHIAVELYQGHVRVSYDPGSYPSSAIYSAETINDGQFHTVELVAFDQMVNL
SIDGGSPMTMDNFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTGFHGCIRNLYIN
NELQDFTKTQMKPGVVPGCEPCRKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADGP
CHGHKCVHGQCVPLDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCLHGHCQASGTKGA
HCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCQG
LRLKRRKFTFECSDGTSFAEEVEKPTKCGCALCA
NT seq 4605 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgactcccgggtgggggtcctcggcggggccggtccggccggagctctggctg
ctgctgtgggcagccgcgtggcgcctgggtgcctcggcgtgccccgccctctgcacctgc
accggaaccacggtggactgccacggcacggggctgcaggccattcccaagaatatacct
cggaacaccgagcgcctggaactcaatggcaacaacatcactcggatccataagaatgac
tttgcggggctcaagcagctgcgggtgctgcagctgatggagaaccagattggagcagtg
gaacgtggtgcttttgatgacatgaaggagctggagcggctgcgactgaaccgaaaccag
ctgcacatgttaccggaactgctgttccagaacaaccaggctttgtcaagactggacttg
agtgagaacgccatccaggccatccccaggaaagcttttcggggagctacggaccttaaa
aatttacagctggacaagaaccagatcagctgcattgaggaaggggccttccgtgctctg
cgggggctggaggtgctgaccctgaacaacaacaatatcaccaccatccccgtgtccagc
ttcaaccatatgcccaagctacggaccttccgcctgcactccaaccacctgttttgcgac
tgccacctggcctggctctcgcagtggctgaggcagcggccaaccatcgggctcttcacc
cagtgctcgggcccagccagcctgcgtggcctcaatgtggcagaggtccagaagagtgag
ttcagctgctcaggccagggagaagcggggcgcgtgcccacctgcaccctgtcctccggc
tcctgcccggccatgtgcacctgcagcaatggcatcgtggactgtcgtggaaaaggcctc
actgccatcccggccaacctgcccgagaccatgacggagatacgcctggagctgaacggc
atcaagtccatccctcctggagccttctcaccctacagaaagctacggaggatagacctg
agcaacaatcagatcgctgagattgcacccgacgccttccagggcctccgctccctgaac
tcgctggtcctctatggaaacaagatcacagacctcccccgtggtgtgtttggaggccta
tacaccctacagctcctgctcctgaatgccaacaagatcaactgcatccggcccgatgcc
ttccaggacctgcagaacctctcactgctctccctgtatgacaacaagatccagagcctc
gccaagggcactttcacctccctgcgggccatccagactctgcacctggcgcagaaccct
ttcatttgcgactgtaacctcaagtggctggcagacttcctgcgcaccaatcccatcgag
acgagtggtgcccgctgtgccagtccccggcgcctcgccaacaagcgcatcgggcagatc
aagagcaagaagttccggtgctcagccaaagagcagtacttcattccaggcacggaggat
taccagctgaacagcgagtgcaacagcgacgtggtctgtccccacaagtgccgctgtgag
gccaacgtggtggagtgctccagcctgaagctcaccaagatccctgagcgcatcccccag
tccacggcagaactgcgattgaataacaatgagatttccatcctggaggccactgggatg
tttaaaaaacttacacatctgaagaaaatcaatctgagcaacaacaaggtgtcagaaatt
gaagatggggccttcgagggcgcagcctctgtgagcgagctgcacctaactgccaaccag
ctggagtccatccggagcggcatgttccggggtctggatggcttgaggaccctaatgctg
cggaacaaccgcatcagctgcatccacaacgacagcttcacgggcctgcgcaacgtccgg
ctcctctcgctctacgacaaccagatcaccaccgtatccccaggagccttcgacaccctc
cagtccctctccacactgaatctcctggccaaccctttcaactgcaactgccagctggcc
tggctaggaggctggctacggaagcgcaagatcgtgacggggaacccgcgatgccagaac
cctgactttttgcggcagattcccctgcaggacgtggccttccctgacttcaggtgtgag
gaaggccaggaggaggggggctgcctgccccgcccacagtgcccacaggagtgcgcctgc
ctggacaccgtggtccgatgcagcaacaagcacctgcgggccctgcccaagggcattccc
aagaatgtcacagaactctatttggacgggaaccagttcacgctggttccgggacagctg
tctaccttcaagtacctgcagctcgtggacctgagcaacaacaagatcagttccttaagc
aattcctccttcaccaacatgagccagctgaccactctgatcctcagctacaatgccctg
cagtgcatcccgcctttggccttccagggactccgctccctgcgcctgctgtctctccac
ggcaatgacatctccaccctccaagagggcatctttgcagacgtgacctccctgtctcac
ctggccattggtgccaaccccctatactgtgactgccacctccgctggctgtccagctgg
gtgaagactggctacaaggaaccgggcattgctcgttgtgctgggccccaggacatggag
ggcaagctgctcctcaccacgcctgccaagaagtttgaatgccaaggtcctccaacgctg
gctgtccaggccaagtgtgatctctgcttgtccagtccgtgccagaaccagggcacctgc
cacaacgacccccttgaggtgtacaggtgcgcctgccccagcggctataagggtcgagac
tgtgaggtgtccctggacagctgttccagtggcccctgtgaaaatgggggcacctgccat
gcacaggagggcgaggatgccccgttcacgtgctcctgtcccaccggctttgaaggacca
acctgtggggtgaacacagatgactgtgtggatcatgcctgtgccaatgggggcgtctgt
gtggatggtgtgggcaactacacctgccagtgccccctgcagtatgagggaaaggcctgt
gagcagctggtggacttgtgctctccggatctgaacccatgtcaacacgaggcccagtgt
gtgggcaccccggatgggcccaggtgtgagtgcatgccaggttatgcaggtgacaactgc
agtgagaaccaggatgactgcagggaccaccgctgccagaatggggcccagtgtatggat
gaagtcaacagctactcctgcctctgtgctgagggctacagtggacagctctgtgagatc
cctccccatctgcctgcccccaagagcccctgtgaggggactgagtgccagaatggggcc
aactgtgtggaccagggcaacaggcctgtgtgccagtgcctcccaggcttcggtggccct
gagtgtgagaagttgctcagtgtcaactttgtggatcgggacacttacctgcagttcact
gacctgcaaaactggccacgggccaacatcacgttgcaggtctccacggcagaggacaat
gggatccttctgtacaacggggacaacgaccacattgcagttgagctgtaccagggccat
gtgcgtgtcagctacgacccaggcagctaccccagctctgccatctacagtgctgagacg
atcaacgatgggcaattccacaccgttgagctggttgcctttgaccagatggtgaatctc
tccattgatggcgggagccccatgaccatggacaactttggcaaacattacacgctcaac
agcgaggcgccactctatgtgggagggatgcccgtggatgtcaactcagctgccttccgc
ctgtggcagatcctcaacggcaccggcttccacggttgcatccgaaacctgtacatcaac
aacgagctgcaggacttcaccaagacgcagatgaagccaggcgtggtgccaggctgcgaa
ccctgccgcaagctctactgcctgcatggcatctgccagcccaatgccaccccagggccc
atgtgccactgcgaggctggctgggtgggcctgcactgtgaccagcccgctgacggcccc
tgccatggccacaagtgtgtccatgggcaatgcgtgcccctcgacgctctttcctacagc
tgccagtgccaggatgggtactcgggggcactgtgcaaccaggccggggccctggcagag
ccctgcagaggcctgcagtgcctgcatggccactgccaggcctcaggcaccaagggggca
cactgtgtgtgtgaccccggcttttcgggcgagctgtgtgagcaagagtccgagtgccgg
ggggaccctgtccgggactttcaccaggtccagaggggctatgccatctgccagaccacg
cgccccctgtcatgggtggagtgccggggctcgtgcccaggccagggctgctgccagggc
cttcggctgaagcggaggaagttcacctttgagtgcagcgatgggacctcttttgccgag
gaggtggaaaagcccaccaagtgtggctgtgccctctgcgcatag

DBGET integrated database retrieval system