KEGG   Homo sapiens (human): 6586Help
Entry
6586              CDS       T01001                                 

Gene name
SLIT3, MEGF5, SLIL2, SLIT1, Slit-3, slit2
Definition
(RefSeq) slit guidance ligand 3
  KO
K06850  slit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    6586 (SLIT3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Axon guidance molecules
   6586 (SLIT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 EGF LRR_5 LRR_4 hEGF LRR_9 Laminin_G_2 LRRNT Laminin_G_1 LRRCT EGF_3 Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 6586
NCBI-ProteinID: NP_003053
OMIM: 603745
HGNC: 11087
Ensembl: ENSG00000184347
Vega: OTTHUMG00000130409
Pharos: O75094(Tbio)
UniProt: O75094
Position
5q34-q35.1
AA seq 1523 aa AA seqDB search
MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIP
RNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNK
LQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRAL
RDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQFT
LCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSISCPSPCTCSNNIVDCRGKGLME
IPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSL
VLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISK
GLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKS
KKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLN
DNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRV
FRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINL
LSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNEESSCQ
LSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRELSALRHLTLI
DLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPE
GSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPT
HRFQCKGPVDINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCI
QNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVC
ICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPLDKGFSCECVPGYSGKLCETDNDDCVA
HKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPPPMVLLQTSPCDQYECQNGAQCIVVQQE
PTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGD
NDPLALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPK
SLGKLQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKA
LPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHG
KCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSG
EHCQQENPCLGQVVREVIRRQKGYASCATASKVPIMECRGGCGPQCCQPTRSKRRKYVFQ
CTDGSSFVEEVERHLECGCLACS
NT seq 4572 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgggtgggcaggggtcggcgccgccgtgcgcgcccgcctggcgctggccttg
gcgctggcgagcgtcctgagtgggcctccagccgtcgcctgccccaccaagtgtacctgc
tccgctgccagcgtggactgccacgggctgggcctccgcgcggttcctcggggcatcccc
cgcaacgctgagcgccttgacctggacagaaataatatcaccaggatcaccaagatggac
ttcgctgggctcaagaacctccgagtcttgcatctggaagacaaccaggtcagcgtcatc
gagagaggcgccttccaggacctgaagcagctagagcgactgcgcctgaacaagaataag
ctgcaagtccttccagaattgcttttccagagcacgccgaagctcaccagactagatttg
agtgaaaaccagatccaggggatcccgaggaaggcgttccgcggcatcaccgatgtgaag
aacctgcaactggacaacaaccacatcagctgcattgaagatggagccttccgagcgctg
cgcgatttggagatccttaccctcaacaacaacaacatcagtcgcatcctggtcaccagc
ttcaaccacatgccgaagatccgaactctgcgcctccactccaaccacctgtactgcgac
tgccacctggcctggctctcggattggctgcgacagcgacggacagttggccagttcaca
ctctgcatggctcctgtgcatttgaggggcttcaacgtggcggatgtgcagaagaaggag
tacgtgtgcccagccccccactcggagcccccatcctgcaatgccaactccatctcctgc
ccttcgccctgcacgtgcagcaataacatcgtggactgtcgaggaaagggcttgatggag
attcctgccaacttgccggagggcatcgtcgaaatacgcctagaacagaactccatcaaa
gccatccctgcaggagccttcacccagtacaagaaactgaagcgaatagacatcagcaag
aatcagatatcggatattgctccagatgccttccagggcctgaaatcactcacatcgctg
gtcctgtatgggaacaagatcaccgagattgccaagggactgtttgatgggctggtgtcc
ctacagctgctcctcctcaatgccaacaagatcaactgcctgcgggtgaacacgtttcag
gacctgcagaacctcaacttgctctccctgtatgacaacaagctgcagaccatcagcaag
gggctcttcgcccctctgcagtccatccagacactccacttagcccaaaacccatttgtg
tgcgactgccacttgaagtggctggccgactacctccaggacaaccccatcgagacaagc
ggggcccgctgcagcagcccgcgccgactcgccaacaagcgcatcagccagatcaagagc
aagaagttccgctgctcaggctccgaggattaccgcagcaggttcagcagcgagtgcttc
atggacctcgtgtgccccgagaagtgtcgctgtgagggcacgattgtggactgctccaac
cagaagctggtccgcatcccaagccacctccctgaatatgtcaccgacctgcgactgaat
gacaatgaggtatctgttctggaggccactggcatcttcaagaagttgcccaacctgcgg
aaaataaatctgagtaacaataagatcaaggaggtgcgagagggagctttcgatggagca
gccagcgtgcaggagctgatgctgacagggaaccagctggagaccgtgcacgggcgcgtg
ttccgtggcctcagtggcctcaaaaccttgatgctgaggagtaacttgatcggctgtgtg
agtaatgacacctttgccggcctgagttcggtgagactgctgtccctctatgacaatcgg
atcaccaccatcacccctggggccttcaccacgcttgtctccctgtccaccataaacctc
ctgtccaaccccttcaactgcaactgccacctggcctggctcggcaagtggttgaggaag
aggcggatcgtcagtgggaaccctaggtgccagaagccatttttcctcaaggagattccc
atccaggatgtggccatccaggacttcacctgtgatggcaacgaggagagtagctgccag
ctgagcccgcgctgcccggagcagtgcacctgtatggagacagtggtgcgatgcagcaac
aaggggctccgcgccctccccagaggcatgcccaaggatgtgaccgagctgtacctggaa
ggaaaccacctaacagccgtgcccagagagctgtccgccctccgacacctgacgcttatt
gacctgagcaacaacagcatcagcatgctgaccaattacaccttcagtaacatgtctcac
ctctccactctgatcctgagctacaaccggctgaggtgcatccccgtccacgccttcaac
gggctgcggtccctgcgagtgctaaccctccatggcaatgacatttccagcgttcctgaa
ggctccttcaacgacctcacatctctttcccatctggcgctgggaaccaacccactccac
tgtgactgcagtcttcggtggctgtcggagtgggtgaaggcggggtacaaggagcctggc
atcgcccgctgcagtagccctgagcccatggctgacaggctcctgctcaccaccccaacc
caccgcttccagtgcaaagggccagtggacatcaacattgtggccaaatgcaatgcctgc
ctctccagcccgtgcaagaataacgggacatgcacccaggaccctgtggagctgtaccgc
tgtgcctgcccctacagctacaagggcaaggactgcactgtgcccatcaacacctgcatc
cagaacccctgtcagcatggaggcacctgccacctgagtgacagccacaaggatgggttc
agctgctcctgccctctgggctttgaggggcagcggtgtgagatcaacccagatgactgt
gaggacaacgactgcgaaaacaatgccacctgcgtggacgggatcaacaactacgtgtgt
atctgtccgcctaactacacaggtgagctatgcgacgaggtgattgaccactgtgtgcct
gagctgaacctctgtcagcatgaggccaagtgcatccccctggacaaaggattcagctgc
gagtgtgtccctggctacagcgggaagctctgtgagacagacaatgatgactgtgtggcc
cacaagtgccgccacggggcccagtgcgtggacacaatcaatggctacacatgcacctgc
ccccagggcttcagtggacccttctgtgaacaccccccacccatggtcctactgcagacc
agcccatgcgaccagtacgagtgccagaacggggcccagtgcatcgtggtgcagcaggag
cccacctgccgctgcccaccaggcttcgccggccccagatgcgagaagctcatcactgtc
aacttcgtgggcaaagactcctacgtggaactggcctccgccaaggtccgaccccaggcc
aacatctccctgcaggtggccactgacaaggacaacggcatccttctctacaaaggagac
aatgaccccctggcactggagctgtaccagggccacgtgcggctggtctatgacagcctg
agttcccctccaaccacagtgtacagtgtggagacagtgaatgatgggcagtttcacagt
gtggagctggtgacgctaaaccagaccctgaacctagtagtggacaaaggaactccaaag
agcctggggaagctccagaagcagccagcagtgggcatcaacagccccctctaccttgga
ggcatccccacctccaccggcctctctgccttgcgccagggcacggaccggcctctaggc
ggcttccacggatgcatccatgaggtgcgcatcaacaacgagctgcaggacttcaaggcc
ctcccaccacagtccctgggggtgtcaccaggctgcaagtcctgcaccgtgtgcaagcac
ggcctgtgccgctccgtggagaaggacagcgtggtgtgcgagtgccgcccaggctggacc
ggcccactctgcgatcaggaggcccgggacccctgcctcggccacagatgccaccatgga
aaatgtgtggcaactgggacctcatacatgtgcaagtgtgccgagggctatggaggggac
ttgtgtgacaacaagaatgactctgccaatgcctgctcagccttcaagtgtcaccatggg
cagtgccacatctcagaccaaggggagccctactgcctgtgccagcccggctttagcggc
gagcactgccaacaagagaatccgtgcctgggacaagtagtccgagaggtgatccgccgc
cagaaaggttatgcatcatgtgccacagcctccaaggtgcccatcatggaatgtcgtggg
ggctgtgggccccagtgctgccagcccacccgcagcaagcggcggaaatacgtcttccag
tgcacggacggctcctcgtttgtagaagaggtggagagacacttagagtgcggctgcctc
gcgtgttcctaa

DBGET integrated database retrieval system