KEGG   Homo sapiens (human): 6590Help
Entry
6590              CDS       T01001                                 

Gene name
SLPI, ALK1, ALP, BLPI, HUSI, HUSI-I, MPI, WAP4, WFDC4
Definition
secretory leukocyte peptidase inhibitor
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q12
AA seq 132 aa AA seqDB search
MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGK
KRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMG
MCGKSCVSPVKA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccagcggcctcttccccttcctggtgctgcttgccctgggaactctggcacct
tgggctgtggaaggctctggaaagtccttcaaagctggagtctgtcctcctaagaaatct
gcccagtgccttagatacaagaaacctgagtgccagagtgactggcagtgtccagggaag
aagagatgttgtcctgacacttgtggcatcaaatgcctggatcctgttgacaccccaaac
ccaacaaggaggaagcctgggaagtgcccagtgacttatggccaatgtttgatgcttaac
ccccccaatttctgtgagatggatggccagtgcaagcgtgacttgaagtgttgcatgggc
atgtgtgggaaatcctgcgtttcccctgtgaaagcttga

DBGET integrated database retrieval system