KEGG   Homo sapiens (human): 660Help
Entry
660               CDS       T01001                                 

Gene name
BMX, ETK, PSCTK2, PSCTK3
Definition
(RefSeq) BMX non-receptor tyrosine kinase (EC:2.7.10.2)
  KO
K08896  
cytoplasmic tyrosine-protein kinase BMX [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     660 (BMX)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Tec family [OT]
   660 (BMX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.2
AA seq 675 aa AA seqDB search
MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKI
RCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLVKY
HSGFFVDGKFLCCQQSCKAAPGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVL
KMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDF
PDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFPESSSSEEEENLDDYDWFAGN
ISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLY
LAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPDSVSLGNGIWELKREEITLL
KELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCS
KEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAAR
NCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGI
LMWEVFSLGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQ
QLLSSIEPLREKDKH
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaaatctattctagaagaacttcttctcaaaagatcacagcaaaagaagaaa
atgtcaccaaataattacaaagaacggctttttgttttgaccaaaacaaacctttcctac
tatgaatatgacaaaatgaaaaggggcagcagaaaaggatccattgaaattaagaaaatc
agatgtgtggagaaagtaaatctcgaggagcagacgcctgtagagagacagtacccattt
cagattgtctataaagatgggcttctctatgtctatgcatcaaatgaagagagccgaagt
cagtggttgaaagcattacaaaaagagataaggggtaacccccacctgctggtcaagtac
catagtgggttcttcgtggacgggaagttcctgtgttgccagcagagctgtaaagcagcc
ccaggatgtaccctctgggaagcatatgctaatctgcatactgcagtcaatgaagagaaa
cacagagttcccaccttcccagacagagtgctgaagatacctcgggcagttcctgttctc
aaaatggatgcaccatcttcaagtaccactctagcccaatatgacaacgaatcaaagaaa
aactatggctcccagccaccatcttcaagtaccagtctagcgcaatatgacagcaactca
aagaaaatctatggctcccagccaaacttcaacatgcagtatattccaagggaagacttc
cctgactggtggcaagtaagaaaactgaaaagtagcagcagcagtgaagatgttgcaagc
agtaaccaaaaagaaagaaatgtgaatcacaccacctcaaagatttcatgggaattccct
gagtcaagttcatctgaagaagaggaaaacctggatgattatgactggtttgctggtaac
atctccagatcacaatctgaacagttactcagacaaaagggaaaagaaggagcatttatg
gttagaaattcgagccaagtgggaatgtacacagtgtccttatttagtaaggctgtgaat
gataaaaaaggaactgtcaaacattaccacgtgcatacaaatgctgagaacaaattatac
ctggcagaaaactactgttttgattccattccaaagcttattcattatcatcaacacaat
tcagcaggcatgatcacacggctccgccaccctgtgtcaacaaaggccaacaaggtcccc
gactctgtgtccctgggaaatggaatctgggaactgaaaagagaagagattaccttgttg
aaggagctgggaagtggccagtttggagtggtccagctgggcaagtggaaggggcagtat
gatgttgctgttaagatgatcaaggagggctccatgtcagaagatgaattctttcaggag
gcccagactatgatgaaactcagccatcccaagctggttaaattctatggagtgtgttca
aaggaataccccatatacatagtgactgaatatataagcaatggctgcttgctgaattac
ctgaggagtcacggaaaaggacttgaaccttcccagctcttagaaatgtgctacgatgtc
tgtgaaggcatggccttcttggagagtcaccaattcatacaccgggacttggctgctcgt
aactgcttggtggacagagatctctgtgtgaaagtatctgactttggaatgacaaggtat
gttcttgatgaccagtatgtcagttcagtcggaacaaagtttccagtcaagtggtcagct
ccagaggtgtttcattacttcaaatacagcagcaagtcagacgtatgggcatttgggatc
ctgatgtgggaggtgttcagcctggggaagcagccctatgacttgtatgacaactcccag
gtggttctgaaggtctcccagggccacaggctttaccggccccacctggcatcggacacc
atctaccagatcatgtacagctgctggcacgagcttccagaaaagcgtcccacatttcag
caactcctgtcttccattgaaccacttcgggaaaaagacaagcattga

DBGET integrated database retrieval system