KEGG   Homo sapiens (human): 6615Help
Entry
6615              CDS       T01001                                 

Gene name
SNAI1, SLUGH2, SNA, SNAH, SNAIL, SNAIL1, dJ710H13.1
Definition
(RefSeq) snail family zinc finger 1
  KO
K05707  
snail 1
Organism
hsa  Homo sapiens (human)
Pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    6615 (SNAI1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    6615 (SNAI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.2
AA seq 264 aa AA seqDB search
MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLI
WDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSS
LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPC
VCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQA
CARTFSRMSLLHKHQESGCSGCPR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctctttcctcgtcaggaagccctccgaccccaatcggaagcctaactacagc
gagctgcaggactctaatccagagtttaccttccagcagccctacgaccaggcccacctg
ctggcagccatcccacctccggagatcctcaaccccaccgcctcgctgccaatgctcatc
tgggactctgtcctggcgccccaagcccagccaattgcctgggcctcccttcggctccag
gagagtcccagggtggcagagctgacctccctgtcagatgaggacagtgggaaaggctcc
cagccccccagcccaccctcaccggctccttcgtccttctcctctacttcagtctcttcc
ttggaggccgaggcctatgctgccttcccaggcttgggccaagtgcccaagcagctggcc
cagctctctgaggccaaggatctccaggctcgaaaggccttcaactgcaaatactgcaac
aaggaatacctcagcctgggtgccctcaagatgcacatccgaagccacacgctgccctgc
gtctgcggaacctgcgggaaggccttctctaggccctggctgctacaaggccatgtccgg
acccacactggcgagaagcccttctcctgtccccactgcagccgtgccttcgctgaccgc
tccaacctgcgggcccacctccagacccactcagatgtcaagaagtaccagtgccaggcg
tgtgctcggaccttctcccgaatgtccctgctccacaagcaccaagagtccggctgctca
ggatgtccccgctga

DBGET integrated database retrieval system