KEGG   Homo sapiens (human): 6616Help
Entry
6616              CDS       T01001                                 

Gene name
SNAP25, RIC-4, RIC4, SEC9, SNAP, SNAP-25, bA416N4.2, dJ1068F16.2
Definition
synaptosomal-associated protein, 25kDa
Orthology
K18211  
synaptosomal-associated protein 25
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Insulin secretion
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    6616 (SNAP25)
  Nervous system
   04721 Synaptic vesicle cycle
    6616 (SNAP25)
SNAREs [BR:hsa04131]
 SNAP-25 (Qb,c)
  SNAP-25
   6616 (SNAP25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20p12-p11.2
AA seq 206 aa AA seqDB search
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRV
EEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARV
VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDR
IMEKADSNKTRIDEANQRATKMLGSG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagacgcagacatgcgcaatgagctggaggagatgcagcgaagggctgaccag
ttggctgatgagtcgctggaaagcacccgtcgtatgctgcaactggttgaagagagtaaa
gatgctggtatcaggactttggttatgttggatgaacaaggagaacaactcgatcgtgtc
gaagaaggcatgaaccatatcaaccaagacatgaaggaggctgagaaaaatttaaaagat
ttagggaaatgctgtggccttttcatatgtccttgtaacaagcttaaatcaagtgatgct
tacaaaaaagcctggggcaataatcaggacggagtggtggccagccagcctgctcgtgta
gtggacgaacgggagcagatggccatcagtggcggcttcatccgcagggtaacaaatgat
gcccgagaaaatgaaatggatgaaaacctagagcaggtgagcggcatcatcgggaacctc
cgtcacatggccctggatatgggcaatgagatcgatacacagaatcgccagatcgacagg
atcatggagaaggctgattccaacaaaaccagaattgatgaggccaaccaacgtgcaaca
aagatgctgggaagtggttaa

DBGET integrated database retrieval system