KEGG   Homo sapiens (human): 6616Help
Entry
6616              CDS       T01001                                 

Gene name
SNAP25, RIC-4, RIC4, SEC9, SNAP, SNAP-25, bA416N4.2, dJ1068F16.2
Definition
synaptosomal-associated protein, 25kDa
Orthology
K08508  
synaptosomal-associated protein, 23kDa
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Synaptic vesicle cycle
Insulin secretion
Drug target
Other: 
Class
Genetic Information Processing; Folding, sorting and degradation; SNARE interactions in vesicular transport [PATH:hsa04130]
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20p12-p11.2
AA seq 206 aa AA seqDB search
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRV
EEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARV
VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDR
IMEKADSNKTRIDEANQRATKMLGSG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagacgcagacatgcgcaatgagctggaggagatgcagcgaagggctgaccag
ttggctgatgagtcgctggaaagcacccgtcgtatgctgcaactggttgaagagagtaaa
gatgctggtatcaggactttggttatgttggatgaacaaggagaacaactcgatcgtgtc
gaagaaggcatgaaccatatcaaccaagacatgaaggaggctgagaaaaatttaaaagat
ttagggaaatgctgtggccttttcatatgtccttgtaacaagcttaaatcaagtgatgct
tacaaaaaagcctggggcaataatcaggacggagtggtggccagccagcctgctcgtgta
gtggacgaacgggagcagatggccatcagtggcggcttcatccgcagggtaacaaatgat
gcccgagaaaatgaaatggatgaaaacctagagcaggtgagcggcatcatcgggaacctc
cgtcacatggccctggatatgggcaatgagatcgatacacagaatcgccagatcgacagg
atcatggagaaggctgattccaacaaaaccagaattgatgaggccaaccaacgtgcaaca
aagatgctgggaagtggttaa

DBGET integrated database retrieval system