KEGG   Homo sapiens (human): 662Help
Entry
662               CDS       T01001                                 

Gene name
BNIP1, NIP1, SEC20, TRG-8
Definition
(RefSeq) BCL2 interacting protein 1
  KO
K08497  
protein transport protein SEC20
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    662 (BNIP1)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNAP-25[N] (Qb)
   Sec20
    662 (BNIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.1
AA seq 228 aa AA seqDB search
MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQD
LEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDL
LRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSM
SGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccccaagacgtccacgtccggatctgtaaccaagagattgtcaaatttgac
ctggaggtgaaggcgcttattcaggatatccgtgattgttcaggacccttaagtgctctt
actgaactgaatactaaagtaaaagagaaatttcaacagttgcgtcacagaatacaggac
ctggagcagttggctaaagagcaagacaaagaatcagagaaacaacttctactccaggaa
gtggagaatcacaaaaagcagatgctcagcaatcaggcctcatggaggaaagctaatctc
acctgcaaaattgcaatcgacaatctagagaaagcagaacttcttcagggaggagatctc
ttaaggcaaaggaaaaccaccaaagagagcctggcccagacatccagtaccatcactgag
agcctcatggggatcagcaggatgatggcccagcaggtccagcagagcgaggaggccatg
cagtctctagtcacttcttcacgaacgatcctggatgcaaatgaagaatttaagtccatg
tcgggcaccatccagctgggccggaagcttatcacaaaatacaatcgccgggagctgacg
gacaagcttctcatcttccttgcgctagccctgtttcttgctacggtcctctatattgtg
aaaaagcggctctttccatttttgtga

DBGET integrated database retrieval system