KEGG   Homo sapiens (human): 6625Help
Entry
6625              CDS       T01001                                 

Gene name
SNRNP70, RNPU1Z, RPU1, SNRP70, Snp1, U1-70K, U170K, U1AP, U1RNP
Definition
small nuclear ribonucleoprotein 70kDa (U1)
Orthology
K11093  
U1 small nuclear ribonucleoprotein 70kDa
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U1-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6625 (SNRNP70)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   U1 snRNP specific factors
    6625 (SNRNP70)
 Complex B
    6625 (SNRNP70)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3
AA seq 437 aa AA seqDB search
MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRA
ETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLR
REFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVER
GRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSPLPHRDRDRDRERE
RRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRERSKDKDRDRKRRSSRSRERAR
RERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDRDRERRRSHRS
ERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGG
DGYLAPENGYLMEAAPE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacccagttcctgccgcccaaccttctggccctctttgccccccgtgaccctattcca
tacctgccacccctggagaaactgccacatgaaaaacaccacaatcaaccttattgtggc
attgcgccgtacattcgagagtttgaggaccctcgagatgcccctcctccaactcgtgct
gaaacccgagaggagcgcatggagaggaaaagacgggaaaagattgagcggcgacagcaa
gaagtggagacagagcttaaaatgtgggaccctcacaatgatcccaatgctcagggggat
gccttcaagactctcttcgtggcgagagtgaattatgacacaacagaatccaagctccgg
agagagtttgaggtgtacggacctatcaaaagaatacacatggtctacagtaagcggtca
ggaaagccccgtggctatgccttcatcgagtacgaacacgagcgagacatgcactccgct
tacaaacacgcagatggcaagaagattgatggcaggagggtccttgtggacgtggagagg
ggccgaaccgtgaagggctggaggccccggcggctaggaggaggcctcggtggtaccaga
agaggaggggctgatgtgaacatccggcattcaggccgcgatgacacctcccgctacgat
gagaggcccggcccctccccgcttccgcacagggaccgggaccgggaccgtgagcgggag
cgcagagagcggagccgggagcgagacaaggagcgagaacggcgacgctcccgctcccgg
gaccggcggaggcgctcacggagtcgcgacaaggaggagcggaggcgctccagggagcgg
agcaaggacaaggaccgggaccggaagcggcgaagcagccggagtcgggagcgggcccgg
cgggagcgggagcgcaaggaggagctgcgtggcggcggtggcgacatggcggagccctcc
gaggcgggtgacgcgccccctgatgatgggcctccaggggagctcgggcctgacggccct
gacggtccagaggaaaagggccgggatcgtgaccgggagcgacggcggagccaccggagc
gagcgcgagcggcgccgggaccgggatcgtgaccgtgaccgtgaccgcgagcacaaacgg
ggggagcggggcagtgagcggggcagggatgaggcccgaggtgggggcggtggccaggac
aacgggctggagggtctgggcaacgacagccgagacatgtacatggagtctgagggcggc
gacggctacctggctccggagaatgggtatttgatggaggctgcgccggagtga

DBGET integrated database retrieval system