KEGG   Homo sapiens (human): 6628Help
Entry
6628              CDS       T01001                                 

Gene name
SNRPB, CCMS, COD, SNRPB1, Sm-B/B', SmB/B', SmB/SmB', snRNP-B
Definition
(RefSeq) small nuclear ribonucleoprotein polypeptides B and B1
  KO
K11086  
small nuclear ribonucleoprotein B and B'
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Systemic lupus erythematosus
Module
Spliceosome, U1-snRNP
Spliceosome, U2-snRNP
Spliceosome, U4/U6.U5 tri-snRNP
Spliceosome, 35S U5-snRNP
Sm core complex
Disease
H01843  
Cerebrocostomandibular syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6628 (SNRPB)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    6628 (SNRPB)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6628 (SNRPB)
  U2 snRNP components
    6628 (SNRPB)
 Complex B
  U1 snRNP components
    6628 (SNRPB)
  U4/U6.U5 tri-snRNP components
    6628 (SNRPB)
 Complex C
  U2 snRNP components
    6628 (SNRPB)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6628 (SNRPB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P14678(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
20p13
AA seq 240 aa AA seqDB search
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAE
REEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPM
PQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMG
RGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgggcaagagcagcaagatgctgcagcatattgattacaggatgaggtgcatc
ctgcaggacggccggatcttcattggcaccttcaaggcttttgacaagcacatgaatttg
atcctctgtgactgtgatgagttcagaaagatcaagccaaagaactccaaacaagcagaa
agggaagagaagcgagtcctcggtctggtgctgctgcgaggggagaatctggtctcaatg
acagtagagggacctcctcccaaagatactggtattgctcgagttccacttgctggagct
gccgggggcccagggatcggcagggctgctggcagaggaatcccagctggggttcccatg
ccccaggctcctgcaggacttgctgggccagtccgtggggttggcgggccatcccaacag
gtgatgaccccacaaggaagaggtactgttgcagccgctgcagctgctgccacagccagt
attgccggggctccaacccagtacccacctggccgtgggggtcctcccccacctatgggc
cgaggagcaccccctccaggcatgatgggcccacctcctggtatgagacctcctatgggt
cccccaatggggatcccccctggaagagggactccaatgggcatgccccctccgggaatg
cggcctcctccccctgggatgcgagggccccctcccccgggaatgcgcccaccaaggccc
tag

KEGG   Homo sapiens (human): 6632Help
Entry
6632              CDS       T01001                                 

Gene name
SNRPD1, HsT2456, SMD1, SNRPD, Sm-D1
Definition
(RefSeq) small nuclear ribonucleoprotein D1 polypeptide
  KO
K11087  
small nuclear ribonucleoprotein D1
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Systemic lupus erythematosus
Module
Spliceosome, U1-snRNP
Spliceosome, U2-snRNP
Spliceosome, U4/U6.U5 tri-snRNP
Spliceosome, 35S U5-snRNP
Sm core complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6632 (SNRPD1)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    6632 (SNRPD1)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6632 (SNRPD1)
  U2 snRNP components
    6632 (SNRPD1)
 Complex B
  U1 snRNP components
    6632 (SNRPD1)
  U4/U6.U5 tri-snRNP components
    6632 (SNRPD1)
 Complex C
  U2 snRNP components
    6632 (SNRPD1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6632 (SNRPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P62314(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
18q11.2
AA seq 119 aa AA seqDB search
MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSI
RGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgtgagatttttgatgaaattgagtcatgaaactgtaaccattgaattgaag
aacggaacacaggtccatggaacaatcacaggtgtggatgtcagcatgaatacacatctt
aaagctgtgaaaatgaccctgaagaacagagaacctgtacagctggaaacgctgagtatt
cgaggaaataacattcggtattttattctaccagacagtttacctctggatacactactt
gtggatgttgaacctaaggtgaaatctaagaaaagggaagctgttgcaggaagaggcaga
ggaagaggaagaggaagaggacgtggccgtggcagaggaagagggggtcctaggcgataa

KEGG   Homo sapiens (human): 6633Help
Entry
6633              CDS       T01001                                 

Gene name
SNRPD2, SMD2, SNRPD1, Sm-D2
Definition
(RefSeq) small nuclear ribonucleoprotein D2 polypeptide
  KO
K11096  
small nuclear ribonucleoprotein D2
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U1-snRNP
Spliceosome, U2-snRNP
Spliceosome, U4/U6.U5 tri-snRNP
Spliceosome, 35S U5-snRNP
Sm core complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6633 (SNRPD2)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6633 (SNRPD2)
  U2 snRNP components
    6633 (SNRPD2)
 Complex B
  U1 snRNP components
    6633 (SNRPD2)
  U4/U6.U5 tri-snRNP components
    6633 (SNRPD2)
 Complex C
  U2 snRNP components
    6633 (SNRPD2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6633 (SNRPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P62316(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.32
AA seq 118 aa AA seqDB search
MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFD
RHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctcaacaagcccaagagtgagatgaccccagaggagctgcagaagcgagag
gaggaggaatttaacaccggtccactctctgtgctcacacagtcagtcaagaacaatacc
caagtgctcatcaactgccgcaacaataagaaactcctgggccgcgtgaaggccttcgat
aggcactgcaacatggtgctggagaacgtgaaggagatgtggactgaggtacccaagagt
ggcaagggcaagaagaagtccaagccagtcaacaaagaccgctacatctccaagatgttc
ctgcgcggggactcagtcatcgtggtcctgcggaacccgctcatcgccggcaagtag

KEGG   Homo sapiens (human): 6634Help
Entry
6634              CDS       T01001                                 

Gene name
SNRPD3, SMD3, Sm-D3
Definition
(RefSeq) small nuclear ribonucleoprotein D3 polypeptide
  KO
K11088  
small nuclear ribonucleoprotein D3
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Systemic lupus erythematosus
Module
Spliceosome, U1-snRNP
Spliceosome, U2-snRNP
Spliceosome, U4/U6.U5 tri-snRNP
Spliceosome, 35S U5-snRNP
Sm core complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6634 (SNRPD3)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    6634 (SNRPD3)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6634 (SNRPD3)
  U2 snRNP components
    6634 (SNRPD3)
 Complex B
  U1 snRNP components
    6634 (SNRPD3)
  U4/U6.U5 tri-snRNP components
    6634 (SNRPD3)
 Complex C
  U2 snRNP components
    6634 (SNRPD3)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6634 (SNRPD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P62318(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
22q11.23
AA seq 126 aa AA seqDB search
MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQ
VYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGN
IFQKRR
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtctattggtgtgccgattaaagtactgcatgaggccgagggccacattgtgacatgt
gagacgaacaccggtgaggtatatcgggggaagctcattgaagcagaggacaacatgaac
tgccagatgtccaacatcacagtcacatacagagatggccgagtggcacagctggagcag
gtatacatccgtggcagcaaaatccgctttctgattttgcctgacatgctgaagaacgca
cccatgttaaagagcatgaaaaataaaaaccaaggctcaggggctggccgaggaaaagct
gctattctcaaggcccaagtggccgcaagaggaagaggacgtggaatgggacgtggaaac
atctttcaaaagcgaagataa

KEGG   Homo sapiens (human): 6635Help
Entry
6635              CDS       T01001                                 

Gene name
SNRPE, HYPT11, SME, Sm-E, snRNP-E
Definition
(RefSeq) small nuclear ribonucleoprotein polypeptide E
  KO
K11097  
small nuclear ribonucleoprotein E
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U1-snRNP
Spliceosome, U2-snRNP
Spliceosome, U4/U6.U5 tri-snRNP
Spliceosome, 35S U5-snRNP
Sm core complex
Disease
H00786  
Hereditary hypotrichosis simplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6635 (SNRPE)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6635 (SNRPE)
  U2 snRNP components
    6635 (SNRPE)
 Complex B
  U1 snRNP components
    6635 (SNRPE)
  U4/U6.U5 tri-snRNP components
    6635 (SNRPE)
 Complex C
  U2 snRNP components
    6635 (SNRPE)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6635 (SNRPE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P62304(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1q32.1
AA seq 92 aa AA seqDB search
MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDD
AEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atggcgtaccgtggccagggtcagaaagtgcagaaggttatggtgcagcccatcaacctc
atcttcagatacttacaaaatagatcgcggattcaggtgtggctctatgagcaagtgaat
atgcggatagaaggctgtatcattggttttgatgagtatatgaaccttgtattagatgat
gcagaagagattcattctaaaacaaagtcaagaaaacaactgggtcggatcatgctaaaa
ggagataatattactctgctacaaagtgtctccaactag

KEGG   Homo sapiens (human): 6636Help
Entry
6636              CDS       T01001                                 

Gene name
SNRPF, SMF, Sm-F, snRNP-F
Definition
(RefSeq) small nuclear ribonucleoprotein polypeptide F
  KO
K11098  
small nuclear ribonucleoprotein F
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U1-snRNP
Spliceosome, U2-snRNP
Spliceosome, U4/U6.U5 tri-snRNP
Spliceosome, 35S U5-snRNP
Sm core complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6636 (SNRPF)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6636 (SNRPF)
  U2 snRNP components
    6636 (SNRPF)
 Complex B
  U1 snRNP components
    6636 (SNRPF)
  U4/U6.U5 tri-snRNP components
    6636 (SNRPF)
 Complex C
  U2 snRNP components
    6636 (SNRPF)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6636 (SNRPF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P62306(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
12q23.1
AA seq 86 aa AA seqDB search
MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLG
EVLIRCNNVLYIRGVEEEEEDGEMRE
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgagtttacccctcaatcccaaacctttcctcaatggactaacaggaaagccagtgatg
gtgaaacttaagtggggaatggagtacaagggctatctggtatctgtagatggctacatg
aacatgcagcttgcaaatacagaagaatacatagatggagctttgtctggacatctgggt
gaagttttaataaggtgtaataatgtcctttatatcagaggtgtggaagaagaggaagaa
gatggggaaatgagagaatag

KEGG   Homo sapiens (human): 6637Help
Entry
6637              CDS       T01001                                 

Gene name
SNRPG, SMG, Sm-G
Definition
(RefSeq) small nuclear ribonucleoprotein polypeptide G
  KO
K11099  
small nuclear ribonucleoprotein G
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U1-snRNP
Spliceosome, U2-snRNP
Spliceosome, U4/U6.U5 tri-snRNP
Spliceosome, 35S U5-snRNP
Sm core complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6637 (SNRPG)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6637 (SNRPG)
  U2 snRNP components
    6637 (SNRPG)
 Complex B
  U1 snRNP components
    6637 (SNRPG)
  U4/U6.U5 tri-snRNP components
    6637 (SNRPG)
 Complex C
  U2 snRNP components
    6637 (SNRPG)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6637 (SNRPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P62308(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
2p13.3
AA seq 76 aa AA seqDB search
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMV
VIRGNSIIMLEALERV
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagctcaccctcccgagttgaaaaaatttatggacaagaagttatcattgaaa
ttaaatggtggcagacatgtccaaggaatattgcggggatttgatccctttatgaacctt
gtgatagatgaatgtgtggagatggcgactagtggacaacagaacaatattggaatggtg
gtaatacgaggaaatagtatcatcatgttagaagccttggaacgagtataa

DBGET integrated database retrieval system