KEGG   Homo sapiens (human): 6629Help
Entry
6629              CDS       T01001                                 

Gene name
SNRPB2, Msl1, U2B''
Definition
(RefSeq) small nuclear ribonucleoprotein polypeptide B2
  KO
K11094  
U2 small nuclear ribonucleoprotein B''
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U2-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6629 (SNRPB2)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    6629 (SNRPB2)
 Complex B
    6629 (SNRPB2)
 Complex C
   U2 SnRNP specific factors
    6629 (SNRPB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P08579(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
20p12.1
AA seq 225 aa AA seqDB search
MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELG
SSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTT
NKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEV
RLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggatatcagaccaaatcatacaatttatatcaacaatatgaatgacaaaattaaaaag
gaagaattgaagagatccctatatgccctgttttctcagtttggtcatgtggtggacatt
gtggctttaaagaccatgaagatgagggggcaggcctttgtcatatttaaggaactgggc
tcatccacaaatgccttgagacagctacaaggatttccattttatggtaaaccaatgcga
atacagtatgcaaaaacagattcggatataatatcaaaaatgcgtggaacttttgctgac
aaagaaaagaaaaaagaaaagaaaaaagccaaaactgtggaacagactgcaacaaccaca
aacaaaaagcctggccagggaactccaaattcagctaatacccaaggaaattcaacacca
aatcctcaggtccctgattaccctccaaactatattttattccttaataacttaccagaa
gagactaatgagatgatgttatccatgctgtttaatcagttccctggcttcaaggaagta
cgtctggtaccagggaggcatgacattgcttttgttgaatttgaaaatgatgggcaggct
ggagctgccagggatgctttacagggatttaagatcacaccgtcccatgctatgaagatc
acctatgccaagaaataa

DBGET integrated database retrieval system