KEGG   Homo sapiens (human): 6631Help
Entry
6631              CDS       T01001                                 

Gene name
SNRPC, U1C, Yhc1
Definition
(RefSeq) small nuclear ribonucleoprotein polypeptide C
  KO
K11095  
U1 small nuclear ribonucleoprotein C
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U1-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6631 (SNRPC)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   U1 snRNP specific factors
    6631 (SNRPC)
 Complex B
    6631 (SNRPC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P09234(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.31
AA seq 159 aa AA seqDB search
MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQG
KIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAP
GMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagttttattgtgactactgcgatacatacctcacccatgactctccatctgtg
agaaagacacactgcagtggaaggaaacacaaagagaatgtgaaagactattatcagaaa
tggatggaagagcaggctcagagcctgattgacaaaacaacggctgcatttcaacaagga
aagatacctcctactccattctctgctcctcctcctgcaggggcgatgataccacctccc
cccagccttccgggtcctcctcgccctggtatgatgccagcaccccatatggggggccct
cccatgatgccaatgatgggccctcctcctcctgggatgatgccagtgggacctgctcct
ggaatgaggccgcccatgggaggccatatgccaatgatgcctgggcccccaatgatgaga
cctcctgcccgtcccatgatggtgcccactcggcccggaatgactcgaccagacagataa

DBGET integrated database retrieval system