KEGG   Homo sapiens (human): 6633Help
Entry
6633              CDS       T01001                                 

Gene name
SNRPD2, SMD2, SNRPD1, Sm-D2
Definition
(RefSeq) small nuclear ribonucleoprotein D2 polypeptide
  KO
K11096  small nuclear ribonucleoprotein D2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Module
hsa_M00351  Spliceosome, U1-snRNP
hsa_M00352  Spliceosome, U2-snRNP
hsa_M00354  Spliceosome, U4/U6.U5 tri-snRNP
hsa_M00355  Spliceosome, 35S U5-snRNP
hsa_M00398  Sm core complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6633 (SNRPD2)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6633 (SNRPD2)
  U2 snRNP components
    6633 (SNRPD2)
 Complex B
  U1 snRNP components
    6633 (SNRPD2)
  U4/U6.U5 tri-snRNP components
    6633 (SNRPD2)
 Complex C
  U2 snRNP components
    6633 (SNRPD2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6633 (SNRPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LSM Hfq
Motif
Other DBs
NCBI-GeneID: 6633
NCBI-ProteinID: NP_004588
OMIM: 601061
HGNC: 11159
Ensembl: ENSG00000125743
Vega: OTTHUMG00000182130
Pharos: P62316(Tbio)
UniProt: P62316
Structure
PDB: 

Jmol
Position
19q13.32
AA seq 118 aa AA seqDB search
MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFD
RHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctcaacaagcccaagagtgagatgaccccagaggagctgcagaagcgagag
gaggaggaatttaacaccggtccactctctgtgctcacacagtcagtcaagaacaatacc
caagtgctcatcaactgccgcaacaataagaaactcctgggccgcgtgaaggccttcgat
aggcactgcaacatggtgctggagaacgtgaaggagatgtggactgaggtacccaagagt
ggcaagggcaagaagaagtccaagccagtcaacaaagaccgctacatctccaagatgttc
ctgcgcggggactcagtcatcgtggtcctgcggaacccgctcatcgccggcaagtag

DBGET integrated database retrieval system