KEGG   Homo sapiens (human): 6633Help
Entry
6633              CDS       T01001                                 

Gene name
SNRPD2, SMD2, SNRPD1, Sm-D2
Definition
small nuclear ribonucleoprotein D2 polypeptide 16.5kDa
Orthology
K11096  
small nuclear ribonucleoprotein D2
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U1-snRNP
Spliceosome, U2-snRNP
Spliceosome, 35S U5-snRNP
Sm core complex
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 118 aa AA seqDB search
MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFD
RHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctcaacaagcccaagagtgagatgaccccagaggagctgcagaagcgagag
gaggaggaatttaacaccggtccactctctgtgctcacacagtcagtcaagaacaatacc
caagtgctcatcaactgccgcaacaataagaaactcctgggccgcgtgaaggccttcgat
aggcactgcaacatggtgctggagaacgtgaaggagatgtggactgaggtacccaagagt
ggcaagggcaagaagaagtccaagccagtcaacaaagaccgctacatctccaagatgttc
ctgcgcggggactcagtcatcgtggtcctgcggaacccgctcatcgccggcaagtag

DBGET integrated database retrieval system