KEGG   Homo sapiens (human): 6636Help
Entry
6636              CDS       T01001                                 

Gene name
SNRPF, SMF, Sm-F, snRNP-F
Definition
(RefSeq) small nuclear ribonucleoprotein polypeptide F
  KO
K11098  
small nuclear ribonucleoprotein F
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U1-snRNP
Spliceosome, U2-snRNP
Spliceosome, U4/U6.U5 tri-snRNP
Spliceosome, 35S U5-snRNP
Sm core complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6636 (SNRPF)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6636 (SNRPF)
  U2 snRNP components
    6636 (SNRPF)
 Complex B
  U1 snRNP components
    6636 (SNRPF)
  U4/U6.U5 tri-snRNP components
    6636 (SNRPF)
 Complex C
  U2 snRNP components
    6636 (SNRPF)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6636 (SNRPF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q23.1
AA seq 86 aa AA seqDB search
MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLG
EVLIRCNNVLYIRGVEEEEEDGEMRE
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgagtttacccctcaatcccaaacctttcctcaatggactaacaggaaagccagtgatg
gtgaaacttaagtggggaatggagtacaagggctatctggtatctgtagatggctacatg
aacatgcagcttgcaaatacagaagaatacatagatggagctttgtctggacatctgggt
gaagttttaataaggtgtaataatgtcctttatatcagaggtgtggaagaagaggaagaa
gatggggaaatgagagaatag

DBGET integrated database retrieval system