KEGG   Homo sapiens (human): 665Help
Entry
665               CDS       T01001                                 

Gene name
BNIP3L, BNIP3a, NIX
Definition
(RefSeq) BCL2 interacting protein 3 like
  KO
K15465  
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
Organism
hsa  Homo sapiens (human)
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    665 (BNIP3L)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   665 (BNIP3L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p21
AA seq 219 aa AA seqDB search
MSSHLVEPPPPLHNNNNNCEENEQSLPPPAGLNSSWVELPMNSSNGNDNGNGKNGGLEHV
PSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQS
EEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMKKGGI
FSAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSASTY
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcccacctagtcgagccgccgccgcccctgcacaacaacaacaacaactgcgag
gaaaatgagcagtctctgcccccgccggccggcctcaacagttcctgggtggagctaccc
atgaacagcagcaatggcaatgataatggcaatgggaaaaatggggggctggaacacgta
ccatcctcatcctccatccacaatggagacatggagaagattcttttggatgcacaacat
gaatcaggacagagtagttccagaggcagttctcactgtgacagcccttcgccacaagaa
gatgggcagatcatgtttgatgtggaaatgcacaccagcagggaccatagctctcagtca
gaagaagaagttgtagaaggagagaaggaagtcgaggctttgaagaaaagtgcggactgg
gtatcagactggtccagtagacccgaaaacattccacccaaggagttccacttcagacac
cctaaacgttctgtgtctttaagcatgaggaaaagtggagccatgaagaaagggggtatt
ttctccgcagaatttctgaaggtgttcattccatctctcttcctttctcatgttttggct
ttggggctaggcatctatattggaaagcgactgagcacaccctctgccagcacctactga

DBGET integrated database retrieval system