KEGG   Homo sapiens (human): 6672Help
Entry
6672              CDS       T01001                                 

Gene name
SP100, lysp100b
Definition
SP100 nuclear antigen
Orthology
K15413  
nuclear autoantigen Sp-100
Organism
hsa  Homo sapiens (human)
Pathway
Herpes simplex infection
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.1
AA seq 885 aa AA seqDB search
MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRN
KVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRNLVPVQRVVYNVLSELEKTFNLP
VLEALFSDVNMQEYPDLIHIYKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENS
FRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQ
KAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK
PFSNSKVECQAQARTHHNQASDIIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPL
ESNDEKEGQEATCSRPQIVPEPMDFRKLSTFRESFKKRVIGQDHDFSESSEEEAPAEASS
GALRSKHGEKAPMTSRSTSTWRIPSRKRRFSSSDFSDLSNGEELQETCSSSLRRGSGSQP
QEPENKKCSCVMCFPKGVPRSQEARTESSQASDMMDTMDVENNSTLEKHSGKRRKKRRHR
SKVNGLQRGRKKDRPRKHLTLNNKVQKKRWQQRGRKANTRPLKRRRKRGPRIPKDENINF
KQSELPVTCGEVKGTLYKERFKQGTSKKCIQSEDKKWFTPREFEIEGDRGASKNWKLSIR
CGGYTLKVLMENKFLPEPPSTRKKRILESHNNTLVDPCPENSNICEVCNKWGRLFCCDTC
PRSFHEHCHIPSVEANKNPWSCIFCRIKTIQERCPESQSGHQESEVLMRQMLPEEQLKCE
FLLLKVYCDSKSCFFASEPYYNREGSQGPQKPMWLNKVKTSLNEQMYTRVEGFVQDMRLI
FHNHKEFYREDKFTRLGIQVQDIFEKNFRNIFAIQETSKNIIMFI
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtgggggcggcgacctgagcaccaggaggctgaatgaatgtatttcaccagta
gcaaatgagatgaaccatcttcctgcacacagccacgatttgcaaaggatgttcacggaa
gaccagggtgtagatgacaggctgctctatgacattgtattcaagcacttcaaaagaaat
aaggtggagatttcaaatgcaataaaaaagacatttccattcctcgagggcctccgtgat
cgtgatctcatcacaaataaaatgtttgaagattctcaagattcttgtagaaacctggtc
cctgtacagagagtggtgtacaatgttcttagtgaactggagaagacatttaacctgcca
gttctggaagcactgttcagcgatgtcaacatgcaggaataccccgatttaattcacatt
tataaaggctttgaaaatgtaatccatgacaaattgcctctccaagaaagtgaagaagaa
gagagggaggagaggtctggcctccaactaagtcttgaacaaggaactggtgaaaactct
tttcgaagcctgacttggccaccttcgggttccccatctcatgctggtacaaccccacct
gaaaatggactctcagagcacccctgtgaaacagaacagataaatgcaaagagaaaagat
acaaccagtgacaaagatgattcgctaggaagccaacaaacaaatgaacaatgtgctcaa
aaggctgagccaacagagtcctgcgaacaaattgctgtccaagtgaataatggggatgct
ggaagggagatgccctgcccgttgccctgtgatgaagaaagcccagaggcagagctacac
aaccatggaatccaaattaattcctgttctgtgcgactggtggatataaaaaaggaaaag
ccattttctaattcaaaagttgagtgccaagcccaagcaagaactcatcataaccaggca
tctgacataatagtcatcagcagtgaggactctgaaggatccactgacgttgatgagccc
ttagaagtcttcatctcagcaccgagaagtgagcctgtgatcaataatgacaacccttta
gaatcaaatgatgaaaaggagggccaagaagccacttgctcacgaccccagattgtacca
gagcccatggatttcagaaaattatctacattcagagaaagttttaagaaaagagtgata
ggacaagaccacgacttttcagaatccagtgaggaggaggcgcccgcagaagcctcgagc
ggggcactgagaagcaagcatggtgagaaggctcctatgacttctagaagtacatctact
tggagaatacccagcaggaagagacgtttcagcagtagtgacttttcagacctgagtaat
ggagaagagcttcaggaaacctgcagctcatccctaagaagagggtcaggatcacagcca
caagaacctgaaaataagaagtgctcctgtgtcatgtgttttccaaaaggtgtgccaaga
agccaagaagcaaggactgaaagtagtcaagcatctgacatgatggataccatggatgtt
gaaaacaattctactttggaaaaacacagtgggaaaagaagaaaaaagagaaggcataga
tctaaagtaaatggtctccaaagagggagaaagaaagacagacctagaaaacatttaact
ctgaataacaaagtccaaaagaaaagatggcaacaaagaggaagaaaagccaacactaga
cctttgaaaagaagaagaaaaagaggtccaagaattcccaaagatgaaaatattaatttt
aaacaatctgaacttcctgtgacctgtggtgaggtgaagggcactctatataaggagcga
ttcaaacaaggaacctcaaagaagtgtatacagagtgaggataaaaagtggttcactccc
agggaatttgaaattgaaggagaccgcggagcatccaagaactggaagctaagtatacgc
tgcggtggatataccctgaaagtcctgatggagaacaaatttctgccagaaccaccaagc
acaagaaaaaagagaatactggaatctcacaacaataccttagttgacccttgtccggaa
aactcaaatatatgtgaggtgtgcaacaaatggggacggctgttctgctgcgacacttgt
ccaagatcctttcatgagcactgccacatcccatccgtggaagctaacaagaacccgtgg
agttgcatcttctgcaggataaagactattcaggaaagatgcccagaaagccaatcaggt
catcaggaatctgaagtcctgatgaggcagatgctgcctgaggagcagttgaaatgtgaa
ttcctcctcttgaaggtctactgtgattcgaaaagctgctttttcgcctcagaaccgtat
tataacagagaggggtctcagggcccacagaagcccatgtggttaaacaaagtcaagaca
agtttgaatgagcagatgtacacccgagtagaagggtttgtgcaggacatgcgtctcatc
tttcataaccacaaggaattttacagggaagataaattcaccagactgggaattcaagta
caggacatctttgagaagaatttcagaaacatttttgcaattcaggaaacaagcaagaac
attataatgtttatttag

DBGET integrated database retrieval system