KEGG   Homo sapiens (human): 6688Help
Entry
6688              CDS       T01001                                 

Gene name
SPI1, OF, PU.1, SFPI1, SPI-1, SPI-A
Definition
spleen focus forming virus (SFFV) proviral integration oncogene
Orthology
K09438  
transcription factor PU.1
Organism
hsa  Homo sapiens (human)
Pathway
Osteoclast differentiation
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia
Disease
H00003  
Acute myeloid leukemia (AML)
Class
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:hsa05221]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p11.2
AA seq 271 aa AA seqDB search
MLQACKMEGFPLVPPQPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVH
SEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCL
QYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDL
LRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTG
EVKKVKKKLTYQFSGEVLGRGGLAERRHPPH
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgttacaggcgtgcaaaatggaagggtttcccctcgtcccccctcagccatcagaagac
ctggtgccctatgacacggatctataccaacgccaaacgcacgagtattacccctatctc
agcagtgatggggagagccatagcgaccattactgggacttccacccccaccacgtgcac
agcgagttcgagagcttcgccgagaacaacttcacggagctccagagcgtgcagcccccg
cagctgcagcagctctaccgccacatggagctggagcagatgcacgtcctcgataccccc
atggtgccaccccatcccagtcttggccaccaggtctcctacctgccccggatgtgcctc
cagtacccatccctgtccccagcccagcccagctcagatgaggaggagggcgagcggcag
agccccccactggaggtgtctgacggcgaggcggatggcctggagcccgggcctgggctc
ctgcctggggagacaggcagcaagaagaagatccgcctgtaccagttcctgttggacctg
ctccgcagcggcgacatgaaggacagcatctggtgggtggacaaggacaagggcaccttc
cagttctcgtccaagcacaaggaggcgctggcgcaccgctggggcatccagaagggcaac
cgcaagaagatgacctaccagaagatggcgcgcgcgctgcgcaactacggcaagacgggc
gaggtcaagaaggtgaagaagaagctcacctaccagttcagcggcgaagtgctgggccgc
gggggcctggccgagcggcgccacccgccccactga

DBGET integrated database retrieval system