KEGG   Homo sapiens (human): 6688Help
Entry
6688              CDS       T01001                                 

Gene name
SPI1, OF, PU.1, SFPI1, SPI-1, SPI-A
Definition
spleen focus forming virus (SFFV) proviral integration oncogene
Orthology
K09438  
transcription factor PU.1
Organism
hsa  Homo sapiens (human)
Pathway
Osteoclast differentiation
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia
Disease
H00003  
Acute myeloid leukemia (AML)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    6688 (SPI1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6688 (SPI1)
   05202 Transcriptional misregulation in cancers
    6688 (SPI1)
   05221 Acute myeloid leukemia
    6688 (SPI1)
  Infectious diseases
   05166 HTLV-I infection
    6688 (SPI1)
   05169 Epstein-Barr virus infection
    6688 (SPI1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    6688 (SPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p11.2
AA seq 271 aa AA seqDB search
MLQACKMEGFPLVPPQPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVH
SEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCL
QYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDL
LRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTG
EVKKVKKKLTYQFSGEVLGRGGLAERRHPPH
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgttacaggcgtgcaaaatggaagggtttcccctcgtcccccctcagccatcagaagac
ctggtgccctatgacacggatctataccaacgccaaacgcacgagtattacccctatctc
agcagtgatggggagagccatagcgaccattactgggacttccacccccaccacgtgcac
agcgagttcgagagcttcgccgagaacaacttcacggagctccagagcgtgcagcccccg
cagctgcagcagctctaccgccacatggagctggagcagatgcacgtcctcgataccccc
atggtgccaccccatcccagtcttggccaccaggtctcctacctgccccggatgtgcctc
cagtacccatccctgtccccagcccagcccagctcagatgaggaggagggcgagcggcag
agccccccactggaggtgtctgacggcgaggcggatggcctggagcccgggcctgggctc
ctgcctggggagacaggcagcaagaagaagatccgcctgtaccagttcctgttggacctg
ctccgcagcggcgacatgaaggacagcatctggtgggtggacaaggacaagggcaccttc
cagttctcgtccaagcacaaggaggcgctggcgcaccgctggggcatccagaagggcaac
cgcaagaagatgacctaccagaagatggcgcgcgcgctgcgcaactacggcaagacgggc
gaggtcaagaaggtgaagaagaagctcacctaccagttcagcggcgaagtgctgggccgc
gggggcctggccgagcggcgccacccgccccactga

DBGET integrated database retrieval system