KEGG   Homo sapiens (human): 6696Help
Entry
6696              CDS       T01001                                 

Gene name
SPP1, BNSP, BSPI, ETA-1, OPN
Definition
secreted phosphoprotein 1
Orthology
K06250  
secreted phosphoprotein 1
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toll-like receptor signaling pathway
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q22.1
AA seq 300 aa AA seqDB search
MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQTL
PSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVT
DFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHME
SEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDES
NEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgcagtgatttgcttttgcctcctaggcatcacctgtgccataccagttaaa
caggctgattctggaagttctgaggaaaagcagctttacaacaaatacccagatgctgtg
gccacatggctaaaccctgacccatctcagaagcagaatctcctagccccacagaccctt
ccaagtaagtccaacgaaagccatgaccacatggatgatatggatgatgaagatgatgat
gaccatgtggacagccaggactccattgactcgaacgactctgatgatgtagatgacact
gatgattctcaccagtctgatgagtctcaccattctgatgaatctgatgaactggtcact
gattttcccacggacctgccagcaaccgaagttttcactccagttgtccccacagtagac
acatatgatggccgaggtgatagtgtggtttatggactgaggtcaaaatctaagaagttt
cgcagacctgacatccagtaccctgatgctacagacgaggacatcacctcacacatggaa
agcgaggagttgaatggtgcatacaaggccatccccgttgcccaggacctgaacgcgcct
tctgattgggacagccgtgggaaggacagttatgaaacgagtcagctggatgaccagagt
gctgaaacccacagccacaagcagtccagattatataagcggaaagccaatgatgagagc
aatgagcattccgatgtgattgatagtcaggaactttccaaagtcagccgtgaattccac
agccatgaatttcacagccatgaagatatgctggttgtagaccccaaaagtaaggaagaa
gataaacacctgaaatttcgtatttctcatgaattagatagtgcatcttctgaggtcaat
taa

DBGET integrated database retrieval system