KEGG   Homo sapiens (human): 6697Help
Entry
6697              CDS       T01001                                 

Gene name
SPR, SDR38C1
Definition
(RefSeq) sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)
  KO
K00072  
sepiapterin reductase [EC:1.1.1.153]
Organism
hsa  Homo sapiens (human)
Pathway
Folate biosynthesis
Metabolic pathways
Disease
H00831  
Primary dystonia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    6697 (SPR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.153  sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming)
     6697 (SPR)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6697 (SPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P35270(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2p13.2
AA seq 261 aa AA seqDB search
MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSG
LRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQV
NNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDML
FQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQK
LLSLLEKDEFKSGAHVDFYDK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgggctggggcgtgctgtgtgcttgctgaccggggcctcccgcggcttcggc
cggacgctggccccgctcctggcctcgctgctgtcgcccggctccgtgcttgtccttagc
gcccgcaacgacgaggcactgcgccagctggaggccgagctgggcgccgagcggtctggc
ctgcgcgtggtgcgggtgcccgccgacctgggcgccgaggccggcttgcagcagctgctc
ggcgccctgcgcgagctcccccggcccaaggggctgcagcgactgctgcttatcaacaac
gcgggctctcttggggatgtgtccaaaggcttcgtggacctgagtgactccactcaagtg
aacaactactgggcactgaacttgacctccatgctctgcctgacttccagcgtcctgaag
gccttcccggacagtcctggcctcaacagaaccgtggttaacatctcgtccctctgtgcc
ctgcaacctttcaaaggctgggcgctgtactgtgcaggaaaggctgctcgtgatatgctg
ttccaggtcctggcgctggaggaacctaatgtgagggtgctgaactatgccccaggtcct
ctggacacagacatgcagcagttggcccgggagacctccgtggacccagacatgcgaaaa
gggctgcaggagctgaaggcaaaggggaagctggtggattgcaaggtgtcagcccagaaa
ctgctgagcttactggaaaaggacgagttcaagtctggagcccacgtggacttctatgac
aaataa

DBGET integrated database retrieval system