KEGG   Homo sapiens (human): 6710Help
Entry
6710              CDS       T01001                                 

Gene name
SPTB, EL3, HS2, HSPTB1, SPH2
Definition
(RefSeq) spectrin beta, erythrocytic
  KO
K06115  
spectrin beta
Organism
hsa  Homo sapiens (human)
Disease
H00230  
Hereditary spherocytosis (SPH)
H00231  
Hereditary elliptocytosis (HE)
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     6710 (SPTB)
  Intermediate filaments
   Intermediate filament-binding proteins
    6710 (SPTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q23.3
AA seq 2137 aa AA seqDB search
MTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFNV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLQSRRQRLETTLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTEGKGY
QPCDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKE
VSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRA
LGKKHKDFLEELEESRGVMEHLEQQAQGFPEEFRDSPDVTHRLQALRELYQQVVAQADLR
QQRLQEALDLYTVFGETDACELWMGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTL
MTQIDGVNLAANSLVESGHPRSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYC
VDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQ
LMDSHPEQKEDIGQRQKHLEELWQGLQQSLQGQEDLLGEVSQLQAFLQDLDDFQAWLSIT
QKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDPEYLLLG
QRLEGLDTGWNALGRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
EAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNN
EKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVA
ELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALHRLWDELQATTKEKTQHLSAARS
SDLRLQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELFA
QVPSMGEEGGDADLSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPL
AQSADYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLG
HLQSSWDRLREAAAGRLQRLRDANEAQQYYLDADEAEAWIGEQELYVISDEIPKDEEGAI
VMLKRHLRQQRAVEDYGRNIKQLASRAQGLLSAGHPEGEQIIRLQGQVDKHYAGLKDVAE
ERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETG
AIGQERVDNVNAFIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLH
RYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVAT
RLQTAYAGEKAEAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWME
SIIRQIETQERPRDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQASEEI
REKLQQVMSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHT
VDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIAERPAEETGPQEEEGETAG
EAPVSHHAATERTSPVSLWSRLSSSWESLQPEPSHPY
NT seq 6414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcggccacagagtttgaaaatgtgggcaaccagccaccttacagcaggatcaat
gcccgctgggacgccccagacgacgagctggataatgacaacagctcagccaggctcttt
gagaggtcccggataaaggccttggcagatgagcgggaagttgttcagaaaaagaccttc
acgaaatgggtgaactcgcacctggctcgagtgtcctgccgcatcaccgatctctacaag
gacctgcgggatgggcgcatgctcatcaagctgctggaggtgctctctggagagatgctg
ccaaagcccaccaaggggaagatgcgcatccactgcctggagaatgtggacaaggctctc
cagttcctcaaggagcagcgtgtacacctggagaacatgggctcccacgacattgtagat
ggcaaccaccgcctggtcctgggcctcatctggaccatcatcctccgcttccagattcag
gacattgtggtccaaactcaggaaggtcgtgaaacacgctcagccaaggatgcgttgctg
ttgtggtgtcagatgaagacggcaggctaccctcatgttaatgtcaccaactttacctcc
agctggaaggatggcttggcctttaatgccctgatacacaagcaccggcccgacctgatc
gactttgataagctgaaggactccaatgcccggcacaacctggagcacgcattcaatgtg
gctgagcgccagctgggcatcatcccgctcctcgaccccgaagatgtctttacggaaaac
cctgatgagaaatccatcatcacctatgtggtggccttttaccactacttctccaagatg
aaggtgctggcagtggagggcaagcgtgtcggcaaggttattgaccatgccattgagact
gagaagatgattgaaaagtacagcgggctagcctcggacctgctcacctggatcgagcag
accatcactgtcctgaacagccgcaagtttgccaactcgctgacgggcgtccagcagcag
ctgcaggccttcagcacctaccgcaccgtggagaagccgcccaagtttcaagagaagggg
aatctggaagttctactttttaccatccagtcccggatgagagccaacaatcagaaagtg
tacacaccccacgatgggaaactagtgtctgacatcaacagggcctgggaaagcctggag
gaagctgagtatcggcgggagctggccctgagaaatgagctcattcggcaggagaagcta
gagcaactggcccggcgctttgaccggaaggccgcaatgagagagacctggctcagtgaa
aaccagcgcctcgtggcccaggataactttgggtatgacctggcagctgtggaggccgcc
aagaagaagcatgaggccatcgagaccgacacggctgcctacgaggagcgggtgagagcc
ctggaggacctggctcaggagctggagaaagagaactaccatgaccagaagcgcatcacg
gcccgcaaggacaatatactgcgcctatggagctacctgcaggagctgctgcagtcccgg
cgccagaggctcgagaccaccctggcactgcagaagctcttccaggacatgctgcacagc
atcgactggatggatgagatcaaggctcacctcttgtctgccgagtttgggaagcacttg
ttggaggttgaagacctgctacagaagcacaagttgatggaagctgacatcgccatccaa
ggggacaaagtgaaggccatcaccgcagccaccctgaagttcaccgaggggaaagggtac
cagccttgtgacccccaggtcatccaggaccgcatcagccacttggagcagtgctttgag
gagctgagcaacatggcagctgggcggaaggcccaactggagcagtccaaacgactctgg
aagttcttctgggagatggatgaggctgagagctggatcaaggagaaggagcagatctat
tcttccctggactatggcaaagacctgaccagtgtgctcatcttacagcgcaagcacaag
gcctttgaggatgagctccgtgggctggatgctcacctggagcagatcttccaggaggct
catggcatggttgcgcgcaagcagtttgggcacccgcagatcgaggcccgcataaaggag
gtgtcggcacagtgggaccagctgaaggacctggctgccttctgcaagaagaacctccag
gatgctgagaactttttccagttccagggcgatgcggatgacctgaaggcttggctgcaa
gacgcccaccggctgctctctggtgaagatgtggggcaggacgaaggggccacgcgggcc
ctggggaaaaagcacaaggacttcctggaggagctggaggagagccgtggggtgatggag
cacctggagcagcaggcccagggattccccgaagagtttcgggattccccagatgtgacc
catcggctgcaggccctgcgggagctctaccaacaggtggtggcccaggcggacctgcgt
cagcagaggctgcaggaagccctggacctgtacacggtgttcggggagacagacgcctgt
gagctgtggatgggagagaaggagaagtggctggccgagatggaaatgccagacaccctg
gaggacctggaggtcgtgcagcacaggttcgacatcctggaccaggagatgaagaccttg
atgactcagattgatggtgtgaacctcgctgccaacagcttggtagagagtggccaccca
cgcagcagggaggtgaagcagtaccaggaccatctgaacaccaggtggcaggcatttcag
accctggtgtcggagcggcgggaggctgtggactcagccctccgagtgcacaactactgc
gtagattgcgaggagaccagcaagtggatcacggacaagacaaaggtagtggagtccaca
aaagacctggggcgggacctggcaggtatcatcgccatccagaggaagttgtcagggctg
gagcgtgacgtggccgccatccaggcccgtgtggatgccctggagcgtgagtcccagcag
ctgatggactcgcaccctgagcagaaggaggatattggtcagcggcaaaaacacttggag
gagctgtggcagggcctgcagcaatccctgcagggccaggaggacttgctgggggaagtc
agccagctgcaggccttcctgcaggatctggatgacttccaggcctggctctccatcacc
cagaaggctgtggcctctgaggacatgcccgaatccctcccagaggctgagcagctcctg
cagcagcatgcaggtatcaaggatgagattgacgggcaccaagacagctaccagcgtgtt
aaggagtctggggagaaagtgatccaaggccagacggacccagagtatctgcttctgggc
cagcggctggagggcctggatactggctggaatgccctgggcaggatgtgggagagccgc
agccacaccctcgctcagtgccttggcttccaggagttccagaaagatgccaagcaggct
gaagccatcctcagcaaccaggaatacactctggctcacttggagcccccagactccctg
gaagctgcagaggctgggatccggaagtttgaggatttcttggggtctatggagaacaac
cgggataaggtcttgagtcctgtggactctggaaacaagctggtagctgagggaaaccta
tactcagacaagatcaaggagaaggtgcagctgattgaggacaggcacaggaagaacaac
gagaaggcccaggaggcctctgtcctactgagagacaacctggagctacagaacttcctc
cagaactgccaggagctcactctctggatcaacgacaagctgctgacatctcaggatgtc
tcctatgatgaagcacgaaaccttcacaataaatggctaaagcaccaggcgtttgtggca
gagctggcttcccatgaagggtggctagagaacatcgatgcggaaggaaagcagctgatg
gatgagaagccccagtttacagccctggtgtcccaaaagctggaagccctgcaccggctc
tgggacgagctgcaggccaccacaaaggagaagacccagcacctctcggctgccaggagc
tccgacctgcgcttgcagacccatgctgacctcaacaagtggatcagcgccatggaggac
cagctgcggtcagacgacccgggcaaggacctgaccagtgtcaatcggatgttggctaag
ctgaagcgagtggaggaccaagtgaatgtgcgaaaagaggagctgggggagctgtttgcc
caggtgccttcaatgggagaggagggaggagatgcagacttgagcatcgagaagcggttc
ctggacctcctggaacccctaggaaggaggaagaagcagctggaatcatccagagccaag
ctgcagatcagccgggacttagaggatgagacgctttgggtggaggagaggctgcctctg
gcccagtcagccgactatggcactaatctgcaaactgtgcaactgttcatgaagaagaac
cagacactgcagaatgagattctgggccatacgccgcgggttgaggatgtgctgcagaga
gggcagcagctggtggaggcggcggagatcgactgccaggaccttgaggagcgcctgggg
cacctgcagagctcctgggacaggctgcgggaggcagcggccgggaggctgcagcgactg
agggacgccaacgaggcacagcagtactacctggatgcagacgaggctgaggcctggatt
ggcgagcaggagctctacgtcatctccgatgagatccccaaggatgaagagggcgccatt
gtgatgctgaagcgacatttgcggcagcagcgtgcggtggaggactacggccggaacatc
aagcagctggccagccgggcccagggcctgctgtctgcaggccaccctgagggggaacag
atcatcagacttcaggggcaagtggacaagcactacgcagggctgaaggacgtggcggaa
gagcgcaagcgcaagctggagaacatgtaccacctgttccagctcaagcgggagaccgac
gacctggagcagtggatttcagaaaaggagctagtggcctcttccccggaaatggggcaa
gactttgaccacgtgactcttctgcgggacaagttccgggactttgcccgggagaccggg
gcgattgggcaggagcgggtggacaatgtgaatgccttcatcgagcgactcatcgacgcg
ggccacagcgaggcggccaccatcgccgagtggaaggacgggctgaacgagatgtgggca
gacctcctggagctcattgacacgcgcatgcagctgctggccgcctcctatgacctgcac
cgctacttctacacgggtgccgagatcctgggcctcatcgacgagaagcaccgcgagctg
cccgaggacgtggggctggacgccagcacggccgagtccttccaccgggtgcacacagcc
ttcgagcgggagctccacctgctgggtgtccaggtgcagcagttccaggacgtggccacc
cgtctgcagacagcatatgctggggagaaggcagaggccatccagaacaaggagcaggag
gtgtctgccgcgtggcaggcgctgctcgatgcctgtgccgggcgccggacccagctagtg
gacacggcggataaattccgcttcttcagcatggcccgtgacctcctctcctggatggag
agcatcatccggcagatcgagacccaggagaggcccagggatgtctcctctgtggaactg
ctcatgaagtatcaccagggcatcaatgcagagattgaaacccggagcaagaacttcagt
gcctgcctggagcttggcgagtccctgctgcagcggcagcaccaggcctcagaggagatc
cgcgagaaactgcagcaggtgatgtccaggaggaaagagatgaatgagaagtgggaagcc
cgctgggagcggctccgcatgttgctggaggtgtgccagttctcgagggatgcctctgtg
gctgaggcgtggctgattgcccaggagccctacctggccagcggggactttggacacaca
gtggacagtgtggagaagctcatcaagaggcatgaggcttttgagaagtccacggccagc
tgggcagagcgctttgctgccctggagaagcccaccacgcttgagctgaaagaacgccag
attgcagagagacccgcagaggagactgggcctcaagaggaggaaggcgagacagcaggg
gaggctccagtttcccaccatgcggccaccgagagaacgtccccggtcagtctctggtct
cgtttgtctagttcctgggagtcactgcagccagagccctctcacccctactag

DBGET integrated database retrieval system