KEGG   Homo sapiens (human): 6711Help
Entry
6711              CDS       T01001                                 

Gene name
SPTBN1, ELF, HEL102, SPTB2, betaSpII
Definition
(RefSeq) spectrin beta, non-erythrocytic 1
  KO
K06115  
spectrin beta
Organism
hsa  Homo sapiens (human)
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     6711 (SPTBN1)
  Intermediate filaments
   Intermediate filament-binding proteins
    6711 (SPTBN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p21
AA seq 2364 aa AA seqDB search
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKI
LSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERII
YIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQ
SLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRL
RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNN
QASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNY
HLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAE
KLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSR
TQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFL
RQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKN
RETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFM
AELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDAN
KAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQ
SQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILW
VGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSA
EAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEK
AKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLY
AGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERF
REFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQI
LAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQV
RQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMV
RDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLAR
KHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYL
SSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRP
PSPEPSTKVSEEAESQQQWDTSKGEQVSQNGLPAEQGSPRMAETVDTSEMVNGATEQRTS
SKESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSR
SWHNVYCVINNQEMGFYKDAKTAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLN
DGNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSASTQSTPASSRAQTLPTSVVTITSES
SPGKREKDKEKDKEKRFSLFGKKK
NT seq 7095 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccacagtagccacagactatgacaacattgagatccagcagcagtacagtgat
gtcaacaaccgctgggatgtcgacgactgggacaatgagaacagctctgcgcggcttttt
gagcggtcccgcatcaaggctctggcagatgagcgtgaagccgtgcagaagaagaccttc
accaagtgggtcaattcccaccttgcccgtgtgtcctgccggatcacagacctgtacact
gaccttcgagatggacggatgctcatcaagctgctggaggtcctctctggagagaggctg
cctaaacccaccaagggacgaatgcgcatccactgcttagagaatgtggacaaggccctt
cagttcctgaaggagcagagagtccatcttgagaacatggggtcccatgacatcgtggat
ggaaaccaccggctgacccttggcctcatctggaccatcatcctgcgcttccagatccag
gatatcagtgtggaaactgaagacaacaaagagaagaaatctgccaaggatgcattgctg
ttgtggtgccagatgaagacagctgggtaccccaatgtcaacattcacaatttcaccact
agctggagggacggcatggccttcaatgcactgatacacaaacaccggcctgacctgata
gattttgacaaactaaagaaatctaacgcacactacaacctgcagaatgcatttaatctg
gcagaacagcacctcggcctcactaaactgttggaccccgaagacatcagcgtggaccat
cctgatgagaagtccataatcacttatgtggtgacttattaccactacttctctaagatg
aaggccttagctgttgaaggaaaacgaattggaaaggtgcttgacaatgctattgaaaca
gaaaaaatgattgaaaagtatgaatcacttgcctctgaccttctggaatggattgaacaa
accatcatcattctgaacaatcgcaaatttgccaattcactggtcggggttcaacagcag
cttcaggcattcaacacttaccgcactgtggagaaaccacccaaatttactgagaagggg
aacttggaagtgctgctcttcaccattcagagcaagatgagggccaacaaccagaaggtc
tacatgccccgggaggggaagctcatctctgacatcaacaaggcctgggaaagactggaa
aaagcggaacacgaaagagaactggctttgcggaatgagctcataagacaggagaaactg
gaacagctcgcccgcagatttgatcgcaaggcagctatgagggagacttggctgagcgaa
aaccagcgtctggtgtctcaggacaactttgggtttgaccttcctgcagttgaggccgcc
acaaaaaagcacgaggccattgagacagacattgccgcatacgaggagcgtgtgcaggct
gtggtagccgtggccagggagctcgaggccgagaattaccacgacatcaagcgcatcaca
gcgaggaaggacaatgtcatccggctctgggaatacctactggaactgctcagggcccgg
agacagcggctcgagatgaacctggggctgcagaagatattccaggaaatgctctacatt
atggactggatggatgaaatgaaggtgctagtattgtctcaagactatggcaaacactta
cttggtgtggaagacctgttacagaagcacaccctggttgaagcagacattggcatccag
gcagagcgggtgagaggtgtcaatgcctccgcccagaagttcgcaacagacggggaaggt
tacaagccctgtgacccccaggtgatccgagaccgcgtggcccacatggagttctgttat
caagagctttgccagctggcggctgagcgcagggcccgtctggaagagtcccgccgcctc
tggaagttcttctgggagatggcagaagaggaaggctggatacgggagaaggagaagatc
ctgtcctcggacgattacgggaaagacctgaccagcgtcatgcgcctgctcagcaagcac
cgggcgttcgaggacgagatgagcggccgcagtggccactttgagcaggccatcaaggaa
ggcgaagacatgatcgcggaggagcacttcgggtcggagaagatccgtgagaggatcatt
tacatccgggagcagtgggccaacctagagcagctctcggccattcggaagaagcgcctg
gaggaggcctccctgctgcaccagttccaggcagatgctgatgacattgatgcctggatg
ctggacatcctcaagattgtctccagcagcgacgtgggccacgatgagtattccacacag
tctctggtcaagaaacacaaggacgtggcggaagagatcgccaattacaggcccaccctt
gacacgctgcacgaacaagccagcgccctcccccaggagcatgccgagtctccagacgtg
aggggcaggctgtcgggcatcgaggagcggtataaggaggtggcagagctgacgcggctg
cggaagcaggcactccaggacactctggccctgtacaagatgttcagcgaggctgatgcc
tgtgagctctggatcgacgagaaggagcagtggctcaacaacatgcagatcccagagaag
ctggaggatctggaggtcatccagcacagatttgagagcctagaaccagaaatgaacaac
caggcttcccgggttgcagtggtgaaccagattgcacgccagctgatgcacagcggccac
ccaagtgagaaggaaatcaaagcccagcaggacaaactcaacacaaggtggagccagttc
agagaactggttgacaggaagaaggatgccctcctgtctgccctgagcatccagaactac
cacctcgagtgcaatgaaaccaaatcctggattcgggaaaagaccaaggtcatcgagtcc
acccaggacctgggcaatgacctggctggcgtcatggccctgcagcgcaagctgaccggc
atggagcgggacttggtggccattgaggcaaagctgagtgacctgcagaaggaggcggag
aagctggagtccgagcaccccgaccaggcccaggccatcctgtctcggctggccgagatc
agcgacgtgtgggaggagatgaagaccaccctgaaaaaccgagaggcctccctgggagag
gccagcaagctgcagcagttcctacgggacttggacgacttccagtcctggctctctagg
acccagacagcgatcgcctcggaggacatgccaaacaccctgaccgaggctgagaagctg
ctcacgcagcacgagaacatcaagaacgagatcgacaactacgaggaggactaccagaag
atgagggacatgggcgagatggtcacccaggggcagaccgatgcccagtacatgtttctg
cggcagcggctgcaggccctggacactggatggaacgagctccacaagatgtgggagaac
agacaaaatctcctatcccagtcacatgcctaccagcagttcctcagagacacgaagcaa
gccgaagcctttcttaacaaccaggagtatgttctggctcacactgaaatgcctaccacc
ttggaaggagctgaagcagcaattaaaaagcaagaggacttcatgaccaccatggacgcc
aatgaggagaagatcaatgctgtggtggagactggccggaggctggtgagcgatgggaac
atcaactcagatcgcatccaggagaaggtggactctattgatgacagacataggaagaat
cgtgagacagccagtgaacttttgatgaggttgaaggacaacagggatctacagaaattc
ctgcaagattgtcaagagctgtctctctggatcaatgagaagatgctcacagcccaggac
atgtcttacgatgaagccagaaatctgcacagtaaatggttgaagcatcaagcatttatg
gcagaacttgcatccaacaaagaatggcttgacaaaatcgagaaggaaggaatgcagctc
atttcagaaaagcctgagacggaagctgtggtgaaggagaaactcactggtttacataaa
atgtgggaagtccttgaatccactacccagacaaaggcccagcggctctttgatgcaaac
aaggccgaacttttcacccagagctgtgcagatctagacaaatggctgcacggcctggag
agtcagattcagtctgatgactatggcaaagacctgaccagtgtcaatatcctgctgaaa
aagcaacagatgctggagaatcagatggaagtgcggaagaaggagatcgaagagctccaa
agccaagcccaggccctgagtcaggaagggaagagcaccgacgaggtagacagcaagcgc
ctcaccgtgcagaccaagttcatggagttgctggagcccttgaacgagaggaagcataac
ctgctggcctccaaagagatccatcagttcaacagggatgtggaggacgagatcttgtgg
gttggagagaggatgcctttggcaacttccacggatcatggccacaacctccagactgtg
cagctgttaataaagaaaaatcagaccctccagaaagaaatccaggggcaccagcctcgc
attgacgacatctttgagaggagccaaaacatcgtcactgacagcagcagcctcagcgct
gaggccatcagacagaggcttgccgacctgaagcagctgtggggtctcctcattgaggag
acagagaaacgccacaggcggctggaggaggcgcacagggcccagcagtactactttgac
gctgctgaggccgaagcctggatgagcgagcaggagctgtacatgatgtcagaggagaag
gccaaggatgagcagagtgctgtctccatgttgaagaagcaccagatcttagaacaagct
gtggaggactatgcagagaccgtgcatcagctctccaagaccagccgggccctggtggcc
gacagccatcctgaaagtgagcgcattagcatgcggcagtccaaagtggataaactgtac
gctggtctgaaagaccttgctgaagagagaagaggcaagctggatgagagacacaggtta
ttccagctcaaccgggaggtggacgacctggagcagtggatcgctgagagggaggtggtc
gcagggtcccatgaactgggacaggactatgagcatgtcacgatgttacaagaacgattc
cgggagtttgcccgagacaccgggaacattgggcaggagcgcgtggacacggtcaatcac
ctggcagatgagctcatcaactctggacattcagatgccgccaccatcgctgaatggaag
gatggcctcaatgaagcctgggccgacctcctggagctcattgacacaagaacacagatt
cttgccgcttcctatgaactgcacaagttttaccacgatgccaaggagatctttgggcgt
atacaggacaaacacaagaaactccctgaggagcttgggagagatcagaacacagtggag
accttacagagaatgcacactacatttgagcatgacatccaggctctgggcacacaggtg
aggcagctgcaggaggatgcagcccgcctccaggcggcctatgcgggtgacaaggccgac
gatatccagaagcgcgagaacgaggtcctggaagcctggaagtccctcctggacgcctgt
gagagccgcagggtgcggctggtggacacaggggacaagttccgcttcttcagcatggtg
cgcgacctcatgctctggatggaggatgtcatccggcagatcgaggcccaggagaagcca
agggatgtatcatctgttgaactcttaatgaataatcatcaaggcatcaaagctgaaatt
gatgcacgtaatgacagtttcacaacctgcattgaacttgggaaatccctgttggcgaga
aaacactatgcatctgaggagatcaaggaaaaattactgcagttgacggaaaagaggaaa
gaaatgatcgacaagtgggaagaccgatgggaatggttaagactgattctggaggtccat
cagttctcaagagacgccagtgtggccgaggcctggctgcttggacaggagccgtaccta
tccagccgagagataggccagagcgtggacgaggtggagaagctcatcaagcgccacgag
gcatttgaaaagtctgcagcaacctgggatgagaggttctctgccctggaaaggctgact
acattggagttactggaagtgcgcagacagcaagaggaagaggagaggaagaggcggccg
ccttctcccgagccgagcacgaaggtttcagaggaagccgagtcccagcagcagtgggat
acttcaaaaggagaacaagtttcccaaaacggtttgccagctgaacagggatctccacgg
atggcagaaacggtggacacaagcgaaatggtcaacggcgctacagaacaaaggacgagc
tctaaagagtccagccccatcccctccccgacctctgatcgtaaagccaagactgccctc
ccagcccagagtgccgccaccttaccagccagaacccaggagacaccttcggcccagatg
gaaggcttcctcaatcggaaacacgagtgggaggcccacaataagaaagcctcaagcagg
tcctggcacaatgtttattgtgtcataaataaccaagaaatgggtttctacaaagatgca
aagactgctgcttctggaattccctaccacagcgaggtccctgtgagtttgaaagaagct
gtctgcgaagtggcccttgattacaaaaagaagaaacacgtattcaagctaagactaaat
gatggcaatgagtacctcttccaagccaaagacgatgaggaaatgaacacatggatccag
gctatctcttccgccatctcctctgataaacacgaggtgtctgccagcacccagagcacg
ccagcatccagccgcgcgcagaccctccccaccagcgtcgtcaccatcaccagcgagtcc
agtcccggcaagcgggaaaaggacaaagagaaagacaaagagaagcggttcagccttttt
ggcaaaaagaaatga

DBGET integrated database retrieval system