KEGG   Homo sapiens (human): 6715Help
Entry
6715              CDS       T01001                                 

Gene name
SRD5A1, S5AR_1
Definition
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) (EC:1.3.1.22)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Drug target
Finasteride: 
Dutasteride: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    6715 (SRD5A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     6715 (SRD5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p15
AA seq 259 aa AA seqDB search
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggcgacgggggtggcggaggagcgcctgctggccgcgctcgcctacctgcag
tgcgccgtgggctgcgcggtcttcgcgcgcaatcgtcagacgaactcagtgtacggccgc
cacgcgctgcccagccacaggctccgagtgccggcgcgggccgcctgggtggtgcaggag
ctgccctcgctggccctgccgctctaccagtacgccagcgagtccgccccgcgtctccgc
agcgcgcccaactgcatcctcctggccatgttcctcgtccactacgggcatcggtgctta
atttacccatttctgatgcgaggaggaaagcctatgccactgttggcgtgtacaatggcg
attatgttctgtacctgtaacggctatttgcaaagcagatacttgagccattgtgcagtg
tatgctgatgactgggtaacagatccccgttttctaataggttttggcttgtggttaacg
ggcatgttgataaacatccattcagatcatatcctaaggaatctcagaaaaccaggagat
actggatacaaaataccaaggggaggcttatttgaatacgtaactgcagccaactatttt
ggagaaatcatggagtggtgtggctatgccctggccagctggtctgtccaaggcgcggct
tttgctttcttcacgttttgttttttatctggtagagcaaaagagcatcatgagtggtac
ctccggaaatttgaagagtatccaaagttcagaaaaattataattccatttttgttttaa

DBGET integrated database retrieval system