KEGG   Homo sapiens (human): 6716Help
Entry
6716              CDS       T01001                                 

Gene name
SRD5A2
Definition
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) (EC:1.3.1.22)
Orthology
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Prostate cancer
Disease
H00608  
46,XY disorders of sex development (Disorders in androgen synthesis or action)
Drug target
Finasteride: 
Dutasteride: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    6716 (SRD5A2)
 Human Diseases
  Cancers
   05215 Prostate cancer
    6716 (SRD5A2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     6716 (SRD5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
2p23
AA seq 254 aa AA seqDB search
MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPS
FAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCT
GNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPFIF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttcagtgccagcagagcccagtgctggcaggcagcgccactttggtcgccctt
ggggcactggccttgtacgtcgcgaagccctccggctacgggaagcacacggagagcctg
aagccggcggctacccgcctgccagcccgcgccgcctggttcctgcaggagctgccttcc
ttcgcggtgcccgcggggatcctcgcccggcagcccctctccctcttcgggccacctggg
acggtacttctgggcctcttctgcctacattacttccacaggacatttgtgtactcactg
ctcaatcgagggaggccttatccagctatactcattctcagaggcactgccttctgcact
ggaaatggagtccttcaaggctactatctgatttactgtgctgaataccctgatgggtgg
tacacagacatacggtttagcttgggtgtcttcttatttattttgggaatgggaataaac
attcatagtgactatatattgcgccagctcaggaagcctggagaaatcagctacaggatt
ccacaaggtggcttgtttacgtatgtttctggagccaatttcctcggtgagatcattgaa
tggatcggctatgccctggccacttggtccctcccagcacttgcatttgcatttttctca
ctttgtttccttgggctgcgagcttttcaccaccataggttctacctcaagatgtttgag
gactaccccaaatctcggaaagcccttattccattcatcttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system