KEGG   Homo sapiens (human): 6718Help
Entry
6718              CDS       T01001                                 

Gene name
AKR1D1, 3o5bred, CBAS2, SRD5B1
Definition
aldo-keto reductase family 1, member D1 (EC:1.3.1.3)
Orthology
K00251  
3-oxo-5-beta-steroid 4-dehydrogenase [EC:1.3.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Steroid hormone biosynthesis
Metabolic pathways
Module
Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Disease
H00628  
Congenital bile acid synthesis defect (CBAS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00120 Primary bile acid biosynthesis
    6718 (AKR1D1)
   00140 Steroid hormone biosynthesis
    6718 (AKR1D1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.3  Delta4-3-oxosteroid 5beta-reductase
     6718 (AKR1D1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q32-q33
AA seq 285 aa AA seqDB search
MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQN
EHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIE
VPMAFKPGDEIYPRDENGKWLYHKSNLCATWEVECHPYFTQPKLLKFCQQHDIVITAYSP
LGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIK
ENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggatctcagtgctgcaagtcaccgcatacctctaagtgatggaaacagcattcccatc
atcggacttggtacctactcagaacctaaatcgacccctaagggagcctgtgcaacatcg
gtgaaggttgctattgacacagggtaccgacatattgatggggcctacatctaccaaaat
gaacacgaagttggggaggccatcagggagaagatagcagaaggaaaggtgcggagggaa
gatatcttctactgtggaaagctatgggctacaaatcatgtcccagagatggtccgccca
accctggagaggacactcagggtcctccagctagattatgtggatctttacatcattgaa
gtacccatggcctttaagccaggagatgaaatataccctagagatgagaatggcaaatgg
ttatatcacaagtcaaatctgtgtgccacttgggaggttgagtgccatccgtatttcacc
cagccaaaactcttgaaattttgccaacaacatgacattgtcattactgcatatagccct
ttggggaccagtaggaatccaatctgggtgaatgtttcttctccacctttgttaaaggat
gcacttctaaactcattggggaaaaggtacaataagacagcagctcaaattgttttgcgt
ttcaacatccagcgaggggtggttgtcattcctaaaagctttaatcttgaaaggatcaaa
gaaaattttcagatctttgacttttctctcactgaagaagaaatgaaggacattgaagcc
ttgaataaaaatgtccgctttgtagaattgctcatgtggcgcgatcatcctgaataccca
tttcatgatgaatactga

DBGET integrated database retrieval system