KEGG   Homo sapiens (human): 6728Help
Entry
6728              CDS       T01001                                 

Gene name
SRP19
Definition
(RefSeq) signal recognition particle 19
  KO
K03105  signal recognition particle subunit SRP19
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    6728 (SRP19)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   6728 (SRP19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRP19 DUF4320
Motif
Other DBs
NCBI-GeneID: 6728
NCBI-ProteinID: NP_003126
OMIM: 182175
HGNC: 11300
Ensembl: ENSG00000153037
Vega: OTTHUMG00000186064
Pharos: P09132(Tbio)
UniProt: P09132
Structure
PDB: 

Jmol
Position
5q22.2
AA seq 144 aa AA seqDB search
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNV
FLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQ
KTGGADQSLQQGEGSKKGKGKKKK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcgctgccgcgcggtccccggccgaccaggacaggtttatttgtatctatcct
gcttatttaaataataagaagaccatcgcagagggaaggcgaatccccataagtaaggct
gttgaaaatcctacagctacagagattcaagatgtatgttcagcagttggacttaacgta
tttcttgagaaaaataaaatgtactctagagaatggaatcgtgatgtccaatacagaggc
agagtccgggtccagctcaaacaggaagatgggagcctctgccttgtacagttcccatca
cgtaagtcagtaatgttgtatgcagcagaaatgatacctaaactaaaaacaaggacacaa
aaaacaggaggtgctgaccaaagtcttcaacaaggagagggaagtaaaaaagggaaagga
aagaaaaagaagtaa

DBGET integrated database retrieval system