KEGG   Homo sapiens (human): 6728Help
Entry
6728              CDS       T01001                                 

Gene name
SRP19
Definition
signal recognition particle 19kDa (EC:3.6.5.4)
Orthology
K03105  
signal recognition particle subunit SRP19
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:hsa03060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q21-q22
AA seq 110 aa AA seqDB search
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNV
FLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSHYTLSLTSGS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcgctgccgcgcggtccccggccgaccaggacaggtttatttgtatctatcct
gcttatttaaataataagaagaccatcgcagagggaaggcgaatccccataagtaaggct
gttgaaaatcctacagctacagagattcaagatgtatgttcagcagttggacttaacgta
tttcttgagaaaaataaaatgtactctagagaatggaatcgtgatgtccaatacagaggc
agagtccgggtccagctcaaacaggaagatgggagcctctgccttgtacagttcccatca
cattatacactaagcctaacttctggttcctag

DBGET integrated database retrieval system