KEGG   Homo sapiens (human): 6729Help
Entry
6729              CDS       T01001                                 

Gene name
SRP54
Definition
(RefSeq) signal recognition particle 54
  KO
K03106  
signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    6729 (SRP54)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     6729 (SRP54)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   6729 (SRP54)
  Eukaryotic Sec-SRP protein
   6729 (SRP54)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q13.2
AA seq 504 aa AA seqDB search
MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI
DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSK
LAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFK
NENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKV
DVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDI
EGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFM
SKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQEL
LTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGL
QSMMRQFQQGAAGNMKGMMGFNNM
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggttctagcagaccttggaagaaaaataacatcagcattacgctcgttgagcaatgcc
accattatcaatgaagaggtattgaatgctatgctaaaagaagtctgtaccgctttgttg
gaagcagatgttaatattaaactagtgaagcaactaagagaaaatgttaagtctgctatt
gatcttgaagagatggcatctggtcttaacaaaagaaaaatgattcagcatgctgtattt
aaagaacttgtgaagcttgtagaccctggagttaaggcatggacacccactaaaggaaaa
caaaatgtgattatgtttgttggattgcaagggagtggtaaaacaacaacatgttcaaag
ctagcatattattaccagaggaaaggttggaagacctgtttaatatgtgcagacacattc
agagcaggggcttttgaccaactaaaacagaatgctaccaaagcaagaattccattttat
ggaagctatacagaaatggatcctgtcatcattgcttctgaaggagtagagaaatttaaa
aatgaaaattttgaaattattattgttgatacaagtggccgccacaaacaagaagactct
ttgtttgaagaaatgcttcaagttgctaatgctatacaacctgataacattgtttatgtg
atggatgcctccattgggcaggcttgtgaagcccaggctaaggcttttaaagataaagta
gatgtagcctcagtaatagtgacaaaacttgatggccatgcaaaaggaggtggtgcactc
agtgcagtcgctgccacaaaaagtccgattattttcattggtacaggggaacatatagat
gactttgaacctttcaaaacacagccttttattagcaaacttcttggtatgggcgacatt
gaaggactgatagataaagtcaacgagttgaagttggatgacaatgaagcacttatagag
aagttgaaacatggtcagtttacgttgcgagacatgtatgagcaatttcaaaatatcatg
aaaatgggccccttcagtcagatcttggggatgatccctggttttgggacagattttatg
agcaaaggaaatgaacaggagtcaatggcaaggctaaagaaattaatgacaataatggat
agtatgaatgatcaagaactagacagtacggatggtgccaaagtttttagtaaacaacca
ggaagaatccaaagagtagcaagaggatcgggtgtatcaacaagagatgttcaagaactt
ttgacacaatataccaagtttgcacagatggtaaaaaagatgggaggtatcaaaggactt
ttcaaaggtggcgacatgtctaagaatgtgagccagtcacagatggcaaaattgaaccaa
caaatggccaaaatgatggatcctagggttcttcatcacatgggtggtatggcaggactt
cagtcaatgatgaggcagtttcaacagggtgctgctggcaacatgaaaggcatgatggga
ttcaataatatgtaa

DBGET integrated database retrieval system