KEGG   Homo sapiens (human): 6729Help
Entry
6729              CDS       T01001                                 

Gene name
SRP54
Definition
signal recognition particle 54kDa
Orthology
K03106  
signal recognition particle subunit SRP54
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    6729 (SRP54)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Bacterial Sec-SRP protein [MD:M00335]
   6729 (SRP54)
  Eukaryotic Sec-SRP protein
   6729 (SRP54)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q13.2
AA seq 455 aa AA seqDB search
MPPLSMKRSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGL
QGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPV
IIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQAC
EAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQP
FISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQIL
GMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARG
SGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPR
VLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgccaccattatcaatgaagaggtctgctattgatcttgaagagatggcatctggtctt
aacaaaagaaaaatgattcagcatgctgtatttaaagaacttgtgaagcttgtagaccct
ggagttaaggcatggacacccactaaaggaaaacaaaatgtgattatgtttgttggattg
caagggagtggtaaaacaacaacatgttcaaagctagcatattattaccagaggaaaggt
tggaagacctgtttaatatgtgcagacacattcagagcaggggcttttgaccaactaaaa
cagaatgctaccaaagcaagaattccattttatggaagctatacagaaatggatcctgtc
atcattgcttctgaaggagtagagaaatttaaaaatgaaaattttgaaattattattgtt
gatacaagtggccgccacaaacaagaagactctttgtttgaagaaatgcttcaagttgct
aatgctatacaacctgataacattgtttatgtgatggatgcctccattgggcaggcttgt
gaagcccaggctaaggcttttaaagataaagtagatgtagcctcagtaatagtgacaaaa
cttgatggccatgcaaaaggaggtggtgcactcagtgcagtcgctgccacaaaaagtccg
attattttcattggtacaggggaacatatagatgactttgaacctttcaaaacacagcct
tttattagcaaacttcttggtatgggcgacattgaaggactgatagataaagtcaacgag
ttgaagttggatgacaatgaagcacttatagagaagttgaaacatggtcagtttacgttg
cgagacatgtatgagcaatttcaaaatatcatgaaaatgggccccttcagtcagatcttg
gggatgatccctggttttgggacagattttatgagcaaaggaaatgaacaggagtcaatg
gcaaggctaaagaaattaatgacaataatggatagtatgaatgatcaagaactagacagt
acggatggtgccaaagtttttagtaaacaaccaggaagaatccaaagagtagcaagagga
tcgggtgtatcaacaagagatgttcaagaacttttgacacaatataccaagtttgcacag
atggtaaaaaagatgggaggtatcaaaggacttttcaaaggtggcgacatgtctaagaat
gtgagccagtcacagatggcaaaattgaaccaacaaatggccaaaatgatggatcctagg
gttcttcatcacatgggtggtatggcaggacttcagtcaatgatgaggcagtttcaacag
ggtgctgctggcaacatgaaaggcatgatgggattcaataatatgtaa

DBGET integrated database retrieval system