KEGG   Homo sapiens (human): 6731Help
Entry
6731              CDS       T01001                                 

Gene name
SRP72, BMFF, HEL103
Definition
signal recognition particle 72kDa
Orthology
K03108  
signal recognition particle subunit SRP72
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:hsa03060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
4q11
AA seq 610 aa AA seqDB search
MASGGSGGVSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGS
FKEALNVINTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLY
RLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPENLGLQEGTHELCY
NTACALIGQGQLNQAMKILQKAEDLCRRSLSEDTDQNVFDSKKKVKLTNAEGVEFKLSKK
QLQAIEFNKALLAMYTNQAEQCRKISASLQSQSPEHLLPVLIQAAQLCREKQHTKAIELL
QEFSDQHPENAAEIKLTMAQLKISQGNISKACLILRSIEELKHKPGMVSALVTMYSHEED
IDSAIEVFTQAIQWYQNHQPKSPAHLSLIREAANFKLKYGRKKEAISDLQQLWKQNPKDI
HTLAQLISAYSLVDPEKAKALSKHLPSSDSMSLKVDVEALENSAGATYIRKKGGKVTGDS
QPKEQGQGDLKKKKKKKKGKLPKNYDPKVTPDPERWLPMRERSYYRGRKKGKKKDQIGKG
TQGATAGASSELDASKTVSSPPTSPRPGSAATVSASTSNIIPPRHQKPAGAPATKKKQQQ
KKKKGGKGGW
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcggcggcagcgggggggtgtcagtacctgcgctgtggagtgaagtgaaccgg
tatggccagaacggcgacttcacgcgcgctctcaagaccgtcaataagatactacagatc
aacaaagatgacgtaactgccctgcattgtaaagtggtatgccttatccagaatggaagt
ttcaaggaagctttgaatgtcatcaatactcacaccaaagtgttagccaataactctctc
tcctttgaaaaggcatattgcgagtacaggctgaacagaattgagaatgccttgaagaca
atagaaagtgccaaccagcagacagacaaactgaaggagctttatggacaagtgttatac
cgtttggaacgctatgatgaatgcttagcagtgtatagagatctcgtccgaaactcccaa
gatgattatgatgaggagaggaaaacaaacctttcagcagttgttgcagctcaaagcaat
tgggaaaaagtggttccagagaacctgggcctccaagaaggcacacatgagctgtgctac
aacactgcatgtgcactgataggccaaggccagctgaaccaggccatgaaaatcctacaa
aaagctgaagatctttgccgccgttcattatcagaagacactgaccaaaatgtctttgac
tccaagaagaaagtgaaattaaccaatgcggaaggagtagagtttaagctttccaagaaa
caactacaagctatagaatttaacaaagctttacttgctatgtacacaaaccaggctgaa
caatgccgcaaaatatctgccagtttacagtcccaaagtcccgagcatctcttacctgtg
ttaatccaagctgcccagctctgccgtgaaaagcagcacacaaaagcaatagagctgctt
caggaattttcagatcagcatccagaaaatgcagctgaaattaagctgaccatggcacag
ttgaaaatttctcaaggtaatatttctaaagcatgtctaatattgagaagcatagaggag
ttaaagcataaaccaggcatggtatctgcattagttaccatgtatagccatgaagaagat
attgatagtgccattgaggtcttcacacaagctatccagtggtatcaaaaccatcagcca
aaatctcctgctcatttgtccttgataagagaagctgcaaacttcaaactcaaatatggg
cggaagaaggaggcaattagtgacctacaacagctgtggaaacaaaatccaaaagatatt
cacaccctggcacagcttatttctgcttactcacttgtagatccagagaaagccaaagct
cttagtaaacacttgccatcgtcagatagtatgtctctaaaagtagatgttgaggctctt
gaaaattctgctggtgctacatacattcggaagaagggtggaaaagttactggagatagt
caaccaaaggaacaaggacagggagatttgaaaaagaagaaaaagaaaaagaagggaaaa
ttgcctaagaattatgacccaaaagttaccccagatccagaaagatggctgccaatgcga
gaacgttcttactaccggggaagaaagaagggtaaaaagaaggatcagattggaaaaggg
acccagggagcaactgcaggagcttcatctgaactggatgccagtaaaactgtgagcagc
ccacccacctccccaagacctggcagtgctgcaacagtatctgcctctacaagtaacatc
atacccccaagacaccagaaacctgcaggggctccagcaacaaaaaagaaacagcaacag
aaaaagaagaaaggtggaaaaggtggctggtga

DBGET integrated database retrieval system