KEGG   Homo sapiens (human): 6731Help
Entry
6731              CDS       T01001                                 

Gene name
SRP72, BMFF, BMFS1, HEL103
Definition
(RefSeq) signal recognition particle 72kDa
  KO
K03108  
signal recognition particle subunit SRP72
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    6731 (SRP72)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   6731 (SRP72)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
4q11
AA seq 671 aa AA seqDB search
MASGGSGGVSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGS
FKEALNVINTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLY
RLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPENLGLQEGTHELCY
NTACALIGQGQLNQAMKILQKAEDLCRRSLSEDTDGTEEDPQAELAIIHGQMAYILQLQG
RTEEALQLYNQIIKLKPTDVGLLAVIANNIITINKDQNVFDSKKKVKLTNAEGVEFKLSK
KQLQAIEFNKALLAMYTNQAEQCRKISASLQSQSPEHLLPVLIQAAQLCREKQHTKAIEL
LQEFSDQHPENAAEIKLTMAQLKISQGNISKACLILRSIEELKHKPGMVSALVTMYSHEE
DIDSAIEVFTQAIQWYQNHQPKSPAHLSLIREAANFKLKYGRKKEAISDLQQLWKQNPKD
IHTLAQLISAYSLVDPEKAKALSKHLPSSDSMSLKVDVEALENSAGATYIRKKGGKVTGD
SQPKEQGQGDLKKKKKKKKGKLPKNYDPKVTPDPERWLPMRERSYYRGRKKGKKKDQIGK
GTQGATAGASSELDASKTVSSPPTSPRPGSAATVSASTSNIIPPRHQKPAGAPATKKKQQ
QKKKKGGKGGW
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcggcggcagcgggggggtgtcagtacctgcgctgtggagtgaagtgaaccgg
tatggccagaacggcgacttcacgcgcgctctcaagaccgtcaataagatactacagatc
aacaaagatgacgtaactgccctgcattgtaaagtggtatgccttatccagaatggaagt
ttcaaggaagctttgaatgtcatcaatactcacaccaaagtgttagccaataactctctc
tcctttgaaaaggcatattgcgagtacaggctgaacagaattgagaatgccttgaagaca
atagaaagtgccaaccagcagacagacaaactgaaggagctttatggacaagtgttatac
cgtttggaacgctatgatgaatgcttagcagtgtatagagatctcgtccgaaactcccaa
gatgattatgatgaggagaggaaaacaaacctttcagcagttgttgcagctcaaagcaat
tgggaaaaagtggttccagagaacctgggcctccaagaaggcacacatgagctgtgctac
aacactgcatgtgcactgataggccaaggccagctgaaccaggccatgaaaatcctacaa
aaagctgaagatctttgccgccgttcattatcagaagacactgatgggactgaggaagac
ccacaggcagaactggccatcattcatggtcagatggcttatattctgcagcttcagggt
cgaacagaggaggctttgcaactttacaatcaaataataaaactaaaaccaacagatgtg
ggattactagctgtaattgcaaataacatcattaccattaacaaggaccaaaatgtcttt
gactccaagaagaaagtgaaattaaccaatgcggaaggagtagagtttaagctttccaag
aaacaactacaagctatagaatttaacaaagctttacttgctatgtacacaaaccaggct
gaacaatgccgcaaaatatctgccagtttacagtcccaaagtcccgagcatctcttacct
gtgttaatccaagctgcccagctctgccgtgaaaagcagcacacaaaagcaatagagctg
cttcaggaattttcagatcagcatccagaaaatgcagctgaaattaagctgaccatggca
cagttgaaaatttctcaaggtaatatttctaaagcatgtctaatattgagaagcatagag
gagttaaagcataaaccaggcatggtatctgcattagttaccatgtatagccatgaagaa
gatattgatagtgccattgaggtcttcacacaagctatccagtggtatcaaaaccatcag
ccaaaatctcctgctcatttgtccttgataagagaagctgcaaacttcaaactcaaatat
gggcggaagaaggaggcaattagtgacctacaacagctgtggaaacaaaatccaaaagat
attcacaccctggcacagcttatttctgcttactcacttgtagatccagagaaagccaaa
gctcttagtaaacacttgccatcgtcagatagtatgtctctaaaagtagatgttgaggct
cttgaaaattctgctggtgctacatacattcggaagaagggtggaaaagttactggagat
agtcaaccaaaggaacaaggacagggagatttgaaaaagaagaaaaagaaaaagaaggga
aaattgcctaagaattatgacccaaaagttaccccagatccagaaagatggctgccaatg
cgagaacgttcttactaccggggaagaaagaagggtaaaaagaaggatcagattggaaaa
gggacccagggagcaactgcaggagcttcatctgaactggatgccagtaaaactgtgagc
agcccacccacctccccaagacctggcagtgctgcaacagtatctgcctctacaagtaac
atcatacccccaagacaccagaaacctgcaggggctccagcaacaaaaaagaaacagcaa
cagaaaaagaagaaaggtggaaaaggtggctggtga

DBGET integrated database retrieval system