KEGG   Homo sapiens (human): 6732Help
Entry
6732              CDS       T01001                                 

Gene name
SRPK1, SFRSK1
Definition
(RefSeq) SRSF protein kinase 1 (EC:2.7.11.1)
  KO
K15409  
serine/threonine-protein kinase SRPK1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    6732 (SRPK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6732 (SRPK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  SRPK family [OT]
   6732 (SRPK1)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    6732 (SRPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.31
AA seq 655 aa AA seqDB search
MERKVLALQARKKRTKAKKDKAQRKSETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPN
DYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTET
ALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSN
YQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQR
SGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAELLEKRMQEIEEMEKESGPGQ
KRPNKQEESESPVERPLKENPPNKMTQEKLEESSTIGQDQTLMERDTEGGAAEINCNGVI
EVINYTQNSNNETLRHKEDLHNANDCDVQNLNQESSFLSSQNGDSSTSQETDSCTPITSE
VSDTMVCQSSSTVGQSFSEQHISQLQESIRAEIPCEDEQEQEHNGPLDNKGKSTAGNFLV
NPLEPKNAEKLKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACM
AFELATGDYLFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHI
TKLKPWGLFEVLVEKYEWSQEEAAGFTDFLLPMLELIPEKRATAAECLRHPWLNS
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggagcggaaagtgcttgcgctccaggcccgaaagaaaaggaccaaggccaagaaggac
aaagcccaaaggaaatctgaaactcagcaccgaggctctgctccccactctgagagtgat
ctaccagagcaggaagaggagattctgggatctgatgatgatgagcaagaagatcctaat
gattattgtaaaggaggttatcatcttgtgaaaattggagatctattcaatgggagatac
catgtgatccgaaagttaggctggggacacttttcaacagtatggttatcatgggatatt
caggggaagaaatttgtggcaatgaaagtagttaaaagtgctgaacattacactgaaaca
gcactagatgaaatccggttgctgaagtcagttcgcaattcagaccctaatgatccaaat
agagaaatggttgttcaactactagatgactttaaaatatcaggagttaatggaacacat
atctgcatggtatttgaagttttggggcatcatctgctcaagtggatcatcaaatccaat
tatcaggggcttccactgccttgtgtcaaaaaaattattcagcaagtgttacagggtctt
gattatttacataccaagtgccgtatcatccacactgacattaaaccagagaacatctta
ttgtcagtgaatgagcagtacattcggaggctggctgcagaagcaacagaatggcagcga
tctggagctcctccgccttccggatctgcagtcagtactgctccccagcctaaaccagct
gacaaaatgtcaaagaataagaagaagaaattgaagaagaagcagaagcgccaggcagaa
ttactagagaagcgaatgcaggaaattgaggaaatggagaaagagtcgggccctgggcaa
aaaagaccaaacaagcaagaagaatcagagagtcctgttgaaagacccttgaaagagaac
ccacctaataaaatgacccaagaaaaacttgaagagtcaagtaccattggccaggatcaa
acgcttatggaacgtgatacagagggtggtgcagcagaaattaattgcaatggagtgatt
gaagtcattaattatactcagaacagtaataatgaaacattgagacataaagaggatcta
cataatgctaatgactgtgatgtccaaaatttgaatcaggaatctagtttcctaagctcc
caaaatggagacagcagcacatctcaagaaacagactcttgtacacctataacatctgag
gtgtcagacaccatggtgtgccagtcttcctcaactgtaggtcagtcattcagtgaacaa
cacattagccaacttcaagaaagcattcgggcagagataccctgtgaagatgaacaagag
caagaacataacggaccactggacaacaaaggaaaatccacggctggaaattttcttgtt
aatccccttgagccaaaaaatgcagaaaagctcaaggtgaagattgctgaccttggaaat
gcttgttgggtgcacaaacatttcactgaagatattcaaacaaggcaatatcgttccttg
gaagttctaatcggatctggctataatacccctgctgacatttggagcacggcatgcatg
gcctttgaactggccacaggtgactatttgtttgaacctcattcaggggaagagtacact
cgagatgaagatcacattgcattgatcatagaacttctggggaaggtgcctcgcaagctc
attgtggcaggaaaatattccaaggaatttttcaccaaaaaaggtgacctgaaacatatc
acgaagctgaaaccttggggcctttttgaggttctagtggagaagtatgagtggtcgcag
gaagaggcagctggcttcacagatttcttactgcccatgttggagctgatccctgagaag
agagccactgccgccgagtgtctccggcacccttggcttaactcctaa

DBGET integrated database retrieval system