KEGG   Homo sapiens (human): 6734Help
Entry
6734              CDS       T01001                                 

Gene name
SRPRA, DP, SRPR, Sralpha
Definition
(RefSeq) SRP receptor alpha subunit
  KO
K13431  
signal recognition particle receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    6734 (SRPRA)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   6734 (SRPRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q24.2
AA seq 638 aa AA seqDB search
MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEALTLKYKLDN
QFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRL
LREAEESSKIRAPTTMKKFEDSEKAKKPVRSMIETRGEKPKEKAKNSKKKGAKKEGSDGP
LATSKPVPAEKSGLPVGPENGVELSKEELIRRKREEFIQKHGRGMEKSNKSTKSDAPKEK
GKKAPRVWELGGCANKEVLDYSTPTTNGTPEAALSEDINLIRGTGSGGQLQDLDCSSSDD
EGAAQNSTKPSATKGTLGGMFGMLKGLVGSKSLSREDMESVLDKMRDHLIAKNVAADIAV
QLCESVANKLEGKVMGTFSTVTSTVKQALQESLVQILQPQRRVDMLRDIMDAQRRQRPYV
VTFCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFRAGAVEQLRTHTRRLSALHPPEK
HGGRTMVQLFEKGYGKDAAGIAMEAIAFARNQGFDVVLVDTAGRMQDNAPLMTALAKLIT
VNTPDLVLFVGEALVGNEAVDQLVKFNRALADHSMAQTPRLIDGIVLTKFDTIDDKVGAA
ISMTYITSKPIVFVGTGQTYCDLRSLNAKAVVAALMKA
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacttcttcaccattttctccaagggcgggcttgtgctctggtgcttccagggc
gttagcgactcatgcaccggacccgttaacgcgttgattcgttccgtgctgctgcaggaa
cggggaggtaacaactccttcacccatgaggcactcacactcaagtataaactggacaac
cagtttgagctggtgtttgtggttggttttcagaagatcctgacactgacatatgtagac
aaattgatagatgacgtgcatcggctgtttcgggacaagtaccgcacagagatccaacag
caaagtgctttaagtttattaaatggcacttttgatttccaaaatgacttcctgcggctc
cttcgtgaagcagaggagagcagtaagatccgtgctcccactaccatgaagaaatttgaa
gattctgaaaaggccaagaaacctgtgaggtccatgattgagacacggggggaaaagccc
aaggaaaaagcaaagaatagcaaaaaaaagggggccaagaaggaaggttctgatggtcct
ttggctaccagcaaaccagtccctgcagaaaagtcaggtcttccagtgggtcctgagaac
ggagtagaactttccaaagaggagctgatccgcaggaagcgcgaggagttcattcagaag
catgggaggggtatggagaagtccaacaagtccacgaagtcagatgctccaaaggagaag
ggcaaaaaagcaccccgggtgtgggaactgggtggctgtgctaacaaagaagtgttggat
tacagtactcccaccaccaatggaacccctgaggctgccttgtctgaggacatcaacctg
attcgagggactgggtctggggggcagcttcaggatctggactgcagcagctctgatgac
gaaggggctgctcaaaactctaccaaacctagtgcgaccaagggaacactgggtggcatg
tttggtatgctgaagggccttgtgggttcaaagagcttgagtcgtgaagacatggaatct
gtgctggacaagatgcgtgatcatctcattgctaagaacgtggctgcagacattgccgtc
cagctctgtgaatctgttgccaacaagttggaagggaaggtgatggggacgttcagcacg
gtgacttccacagtaaagcaagccctacaggagtccctggtgcagattctgcagccacag
cgtcgtgtagacatgctccgggacatcatggatgcccagcgtcgccagcgcccttatgtc
gtcaccttctgcggcgttaatggagtggggaaatctactaatcttgccaagatttccttc
tggttgttagagaatggcttcagtgtcctcattgctgcctgtgatacatttcgtgctggg
gccgtggagcagctgcgtacacacacccggcgtttgagtgccctacaccctccagagaag
catggtggccgcaccatggtgcagttgtttgaaaagggctatggcaaggatgctgctggc
attgccatggaagccattgcttttgcacgtaaccaaggctttgacgtggtgctggtggac
acggcaggccgcatgcaagacaatgcccctctgatgactgccctggccaaactcattact
gtcaatacacctgatttggtgctgtttgtaggagaagccttagtaggcaatgaagccgtg
gaccagctggtcaagttcaacagagccttggctgaccattctatggctcagacacctcgg
ctcattgatggcattgttcttaccaaatttgataccattgatgacaaggtgggagctgct
atttctatgacgtacatcacaagcaaacccatcgtctttgtgggcaccggccagacctac
tgtgacctacgcagcctcaatgccaaggctgtggtggctgccctcatgaaggcttaa

DBGET integrated database retrieval system