KEGG   Homo sapiens (human): 6738Help
Entry
6738              CDS       T01001                                 

Gene name
TROVE2, RO60, RORNP, SSA2
Definition
TROVE domain family, member 2
Orthology
K11089  
60 kDa SS-A/Ro ribonucleoprotein
Organism
hsa  Homo sapiens (human)
Pathway
Systemic lupus erythematosus
Class
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q31
AA seq 525 aa AA seqDB search
MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEA
LIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCR
IPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHK
DLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRD
ELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSE
VSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKT
FKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMV
PCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPA
IALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRALQNTLLNKSF
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatctgtaaaccaaatgcagccactgaatgagaagcagatagccaattctcag
gatggatatgtatggcaagtcactgacatgaatcgactacaccggttcttatgtttcggt
tctgaaggtgggacttattatatcaaagaacagaagttgggccttgaaaatgctgaagct
ttaattagattgattgaagatggcagaggatgtgaagtgatacaagaaataaagtcattt
agtcaagaaggcagaaccacaaagcaagagcctatgctctttgcacttgccatttgttcc
cagtgctccgacataagcacaaaacaagcagcatttaaagctgtttctgaagtttgtcgc
attcctacccatctctttacttttatccagtttaagaaagatctgaaggaaagcatgaaa
tgtggcatgtggggtcgtgccctccggaaggctatagcggactggtacaatgagaaaggt
ggcatggcccttgctctggcagttacaaaatataaacagagaaatggctggtctcacaaa
gatctattaagattgtcacatcttaaaccttccagtgaaggacttgcaattgtgaccaaa
tatattacaaagggctggaaagaagttcatgaattgtataaagaaaaagcactctctgtg
gagactgaaaaattattaaagtatctggaggctgtagagaaagtgaagcgcacaagagat
gagctagaagtcattcatctaatagaagaacatagattagttagagaacatcttttaaca
aatcacttaaagtctaaagaggtatggaaggctttgttacaagaaatgccgcttactgca
ttactaaggaatctaggaaagatgactgctaattcagtacttgaaccaggaaattcagaa
gtatctttagtatgtgaaaaactgtgtaatgaaaaactattaaaaaaggctcgtatacat
ccatttcatattttgatcgcattagaaacttacaagacaggtcatggtctcagagggaaa
ctgaagtggcgccctgatgaagaaattttgaaagcattggatgctgctttttataaaaca
tttaagacagttgaaccaactggaaaacgtttcttactagctgttgatgtcagtgcttct
atgaaccaaagagttttgggtagtatactcaacgctagtacagttgctgcagcaatgtgc
atggttgtcacacgaacagaaaaagattcttatgtagttgctttttccgatgaaatggta
ccatgtccagtgactacagatatgaccttacaacaggttttaatggctatgagtcagatc
ccagcaggtggaactgattgctctcttccaatgatctgggctcagaagacaaacacacct
gctgatgtcttcattgtattcactgataatgagacctttgctggaggtgtccatcctgct
attgctctgagggagtatcgaaagaaaatggatattccagctaaattgattgtttgtgga
atgacatcaaatggtttcaccattgcagacccagatgatagagccttgcaaaatacccta
ctaaataaatcattttag

DBGET integrated database retrieval system