KEGG   Homo sapiens (human): 6742Help
Entry
6742              CDS       T01001                                 

Gene name
SSBP1, Mt-SSB, SOSS-B1, SSBP, mtSSB
Definition
single-stranded DNA binding protein 1, mitochondrial
Orthology
K03111  
single-strand DNA-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    6742 (SSBP1)
   03430 Mismatch repair
    6742 (SSBP1)
   03440 Homologous recombination
    6742 (SSBP1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    6742 (SSBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q34
AA seq 148 aa AA seqDB search
MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLA
TNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYM
DKNNVRRQATTIIADNIIFLSDQTKEKE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgaagacctgtattacaggtacttcgtcagtttgtaagacatgagtccgaaaca
actaccagtttggttcttgaaagatccctgaatcgtgtgcacttacttgggcgagtgggt
caggaccctgtcttgagacaggtggaaggaaaaaatccagtcacaatattttctctagca
actaatgagatgtggcgatcaggggatagtgaagtttaccaactgggtgatgtcagtcaa
aagacaacatggcacagaatatcagtattccggccaggcctcagagacgtggcatatcaa
tatgtgaaaaaggggtctcgaatttatttggaagggaaaatagactatggtgaatacatg
gataaaaataatgtgaggcgacaagcaacaacaatcatagctgataatattatatttctg
agtgaccagacgaaagagaaggagtag

DBGET integrated database retrieval system